KEGG   Glaciecola nitratireducens: GNIT_0015
Entry
GNIT_0015         CDS       T01632                                 

Gene name
polA
Definition
(GenBank) DNA polymerase I
  KO
K02335  DNA polymerase I [EC:2.7.7.7]
Organism
gni  Glaciecola nitratireducens
Pathway
gni03030  DNA replication
gni03410  Base excision repair
gni03420  Nucleotide excision repair
gni03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:gni00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    GNIT_0015 (polA)
   03410 Base excision repair
    GNIT_0015 (polA)
   03420 Nucleotide excision repair
    GNIT_0015 (polA)
   03440 Homologous recombination
    GNIT_0015 (polA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:gni03032]
    GNIT_0015 (polA)
   03400 DNA repair and recombination proteins [BR:gni03400]
    GNIT_0015 (polA)
Enzymes [BR:gni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     GNIT_0015 (polA)
DNA replication proteins [BR:gni03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     GNIT_0015 (polA)
DNA repair and recombination proteins [BR:gni03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA polymerase I
     GNIT_0015 (polA)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     GNIT_0015 (polA)
SSDB
Motif
Pfam: DNA_pol_A 5_3_exonuc_N DNA_pol_A_exo1 5_3_exonuc Sds3 ANAPC15
Other DBs
NCBI-ProteinID: AEP28175
UniProt: G4QEE7
LinkDB
Position
complement(15351..18149)
AA seq 932 aa
MMEKQSTSPLVLVDGSSYLFRAFHGLPPLTNSKGQDTGAIYGVVNMLRSLMTTYKPSHIA
VVFDAKGKTFRDDIYKEYKANRPPMPDELRSQIKPLHKIISAMGFPIIVEDGVEADDVIG
TLARQASEQGIECVISTGDKDMAQLVDQHVTLINTMTNTTMDVDGVTEKFGVPAELIIDY
LAMKGDKVDNIPGIPGVGDKSAVAMLNGIGGVKEIYANLDKIATLDFRGAKTMAAKIAQY
EEQAMLSYQLATIECDLKLEYEPTTLNMGEMDKPELQTLFAEYEFKRWLAEVSDNDSDVT
KASKPLSTDGESSAEDSAQSDNTSSQSFDKAKYELVLTQAQLDEWISKINAAEYYAVDTE
TTSVDYMQAELVGLSFATSENEACYIPVAHDYPGAPEQLERDNVLAQLKPILEDKSAKKI
GQHIKYDKNVLANYDISLQGILSDTMLASYVLNSVATRHNMDSLSLKYLGHNTIHFEDIA
GKGAKQITFNQIALEEAAPYAAEDADVTLRLHKALQALLQDKGELPSVLNDIEVPLSSVL
AKMEQNGVLIDSQLLGQQSQTLAARIMDLEKEVHDLAGEAFNLGSTKQLQHILFEKMSLP
VVKKTPKGAPSTSEEVLQDLALEYELPKKIMEYRGLTKLKNTYTDKLPKMIHHRTGRVHT
SYHQAVTATGRLSSTDPNLQNIPIRTAEGRQVRQAFIARPGYKVVAADYSQIELRIMAHL
SKDKGLVSAFSEGKDIHSATAAEVFDVPLEQVSVNERRSAKAINFGLIYGMSAFGLSKQL
NISRYDAQQYMDLYFERYPGVLTYMESTREGAKETGYVSTVFGRRLYLPDIKASNAMRRK
GAERAAINAPMQGTAADIIKKAMIDVDAWINDIKDEDILMIMQVHDELVFEIKEDRVDEY
VAKIKSLMEDTVKLDVPLVVDVGIGNNWDEAH
NT seq 2799 nt   +upstreamnt  +downstreamnt
atgatggaaaaacaatcaacaagtccgttagtcctagttgacggttcctcttatttattc
agagcctttcacggcctgccccctcttacaaattcaaaaggccaagacacaggcgcgatt
tatggcgtagtcaatatgctgcgtagtttaatgaccacatataagcccagtcatattgct
gtggtttttgacgcgaaagggaaaacgtttagagacgatatttataaagaatacaaagcc
aaccgcccacccatgccggatgaacttcgttcgcaaattaaacctttgcacaaaattatt
agcgcgatgggctttccaattattgtggaagatggagtagaagccgacgatgttatcggt
acattagcgcgccaagcatcagagcaaggaattgagtgtgtcattagtaccggtgacaag
gacatggcccaactcgtcgatcaacacgtcacgcttatcaataccatgacaaataccacc
atggatgtcgacggggtgactgaaaaatttggtgtgcccgccgaactgatcattgattat
ttagcaatgaaaggcgacaaagtagacaacattccaggcattcccggtgttggcgacaag
agtgcagtcgcaatgctcaacggaattggcggcgtaaaagagatttatgcaaatctcgat
aagatagcgacactagactttcgcggcgccaagacgatggccgcaaaaatagcgcagtat
gaagaacaagcgatgctttcttatcaattagccaccattgaatgtgatttaaagcttgaa
tatgaaccgaccactctgaacatgggtgaaatggacaagcctgaactgcagacattgttt
gccgaatatgagtttaaacgttggcttgccgaggttagtgataacgacagcgacgttact
aaagccagcaagccgctatccacagacggtgagtcaagtgccgaggacagcgcgcaaagc
gacaacacgtcatcgcagtctttcgataaggctaaatatgaactcgtgctaacacaagca
caactagatgaatggattagcaaaatcaacgctgcagaatattatgcggttgatactgaa
actactagtgttgactatatgcaggctgaactagttggactgtcattcgccaccagcgaa
aacgaagcctgctacattccagttgcgcatgattatcctggcgcaccagaacaacttgag
cgcgacaacgtgcttgcccaacttaaaccaatattggaagataagtctgcgaagaaaatt
ggtcagcacatcaaatacgacaaaaacgtgctcgccaattacgatatttccctgcaaggg
attttatccgacacaatgctggcgtcatatgtactaaacagtgtggctacacgccataac
atggacagcctgtcgctaaaatacctcggccataatacaattcattttgaagacattgcc
ggcaaaggcgcgaaacaaattacgtttaatcaaattgcattagaagaagctgctccctat
gcggccgaagatgccgatgtgacgcttcgcctgcacaaagcactgcaggctcttctgcaa
gataaaggagaactcccttcagttttgaacgatattgaagtgcctttgtcctcagtattg
gcaaaaatggaacaaaacggggtgttgatcgacagtcagctattaggtcagcaaagtcaa
acattagccgcgcgtattatggatcttgaaaaagaggttcatgatttagccggtgaagca
ttcaacttgggctcgacgaaacagcttcagcacattctttttgaaaaaatgagtttaccg
gtagtgaagaagaccccaaaaggcgctccctctacatcagaggaagtgctgcaagacctt
gctttagaatatgaacttccgaagaagataatggagtatcgtgggctaacgaaactcaaa
aatacctataccgacaagcttcccaagatgatccatcatcgaaccggcagagtgcacacc
tcttatcaccaagcggtgacggcaacgggtcgcctttcttctaccgatcctaacttacag
aatatcccaattagaacagcagaaggaagacaggttcgccaagcattcattgctcgccct
ggctataaagttgtggctgcagattacagtcaaattgagctacgcattatggctcattta
agtaaagataaaggcttagtgagtgcgttttcagaaggcaaagatattcacagtgcgacc
gctgcagaagtatttgatgtgccgctagaacaagtgtctgttaatgaaagacgcagcgcc
aaggccattaactttggtttgatatacggtatgtcagcctttggcctatctaaacaactg
aatatttcgcgctatgatgcgcaacaatatatggacttatattttgaacgttatcctggt
gttttgacctatatggaatctacgcgagaaggtgcgaaagaaacaggctatgttagtacc
gtgtttggccgcagattgtatcttcctgatataaaggcaagcaatgcaatgcgtagaaag
ggtgccgaacgcgctgcaatcaatgcgccgatgcaaggcacagcagcagatattattaaa
aaagcgatgatcgatgttgatgcttggattaacgacatcaaagacgaagatattttaatg
attatgcaggtgcacgatgaattagtttttgaaataaaagaagatcgcgttgacgaatat
gtggcaaaaataaaatcgttaatggaagacactgtcaaacttgacgttccgctagtggtc
gacgttggtatcggtaataattgggatgaagcacattaa

DBGET integrated database retrieval system