KEGG   Glaciecola nitratireducens: GNIT_0281
Entry
GNIT_0281         CDS       T01632                                 

Gene name
nei
Definition
(GenBank) endonuclease VIII
  KO
K05522  endonuclease VIII [EC:3.2.2.- 4.2.99.18]
Organism
gni  Glaciecola nitratireducens
Pathway
gni03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:gni00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    GNIT_0281 (nei)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:gni03400]
    GNIT_0281 (nei)
Enzymes [BR:gni01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     GNIT_0281 (nei)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     GNIT_0281 (nei)
DNA repair and recombination proteins [BR:gni03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     GNIT_0281 (nei)
SSDB
Motif
Pfam: H2TH Fapy_DNA_glyco zf-FPG_IleRS
Other DBs
NCBI-ProteinID: AEP28435
UniProt: G4QF91
LinkDB
Position
318363..319187
AA seq 274 aa
MPEGPEIRLAADQIAKVIENQIIEDIEVGLAHLHSPAQKLKGEKVEEVETRGKAMLIHFC
NGLSVYSHNQLYGVWKVVKRGTLPKTKRSLRLALHTKSNSALLYSASDIAVYERHDLVQH
PFLSKIGPDILNKDLKWESVAERLLDKRFRNRSLSILYLDQHFIAGIGNYLRTEILYAAG
IHPDFKPKQLSPQQLESLARQTLIIGKRAYATKGHTVPKALGEKLAKTKGSYESVRFMAF
NREGLPCRDCVTPIVKAQRNGRRIYWCDLCQLTP
NT seq 825 nt   +upstreamnt  +downstreamnt
atgcctgaaggcccagaaatacgcttagccgctgatcaaattgctaaagtaattgaaaat
caaatcatagaagacattgaggttggcttagcgcacctgcattcacctgcccaaaagttg
aaaggcgaaaaagtggaagaggtagaaacacgtggaaaagcaatgttaattcatttttgt
aacgggctgtcagtgtattcccacaatcaactttacggtgtttggaaagttgttaaacgc
ggcacgttgcccaaaaccaaacgttctttgcgtcttgccctgcacaccaaaagcaacagc
gctttgctttacagtgcatctgatattgcagtttacgagcgtcacgatttagttcagcat
ccatttttaagtaaaattggccccgatattctaaacaaggatttgaaatgggaaagcgtt
gcagagcgtttgctggataagcggtttcgcaacagaagcttgtcaatcttgtacctagat
cagcattttatagctgggataggcaactatttacgtacggaaatactttatgccgcgggt
attcaccctgacttcaaaccaaagcagttgagcccacagcagctagagagtctggcaaga
cagacgctaattataggaaagcgcgcgtatgctacaaaaggccatactgtaccaaaagcg
cttggtgaaaagttagcgaaaaccaaaggtagttacgagagcgttcgatttatggctttc
aatcgcgagggcctgccctgtagagattgcgtgacgcctattgtgaaagcgcaacgtaac
gggcgccggatttattggtgtgacctttgccaattgacgccttaa

DBGET integrated database retrieval system