KEGG   Geodermatophilus obscurus: Gobs_0035Help
Entry
Gobs_0035         CDS       T01163                                 

Definition
(GenBank) serine/threonine protein kinase with PASTA sensor(s)
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
gob  Geodermatophilus obscurus
Brite
KEGG Orthology (KO) [BR:gob00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gob01001]
    Gobs_0035
Enzymes [BR:gob01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Gobs_0035
Protein kinases [BR:gob01001]
 Serine/threonine kinases: Other
  Bacterial family
   Gobs_0035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PASTA Pkinase Pkinase_Tyr APH Pkinase_fungal LytR_C Kdo ABC1 Profilin
Motif
Other DBs
NCBI-ProteinID: ADB72846
UniProt: D2SGG4
LinkDB All DBs
Position
complement(39984..41927)
Genome map
AA seq 647 aa AA seqDB search
MTTPQVLGERYEIGGVLGRGGMAEVHRGRDLRLGREVAVKVLRSDLARDPSFQVRFRREA
QAAASLNHPAIVAVYDTGEDRSSSGATPYIVMEYVEGETLRDVLRREGVLSPARAMDFAA
DICAALDFSHRNGIVHRDVKPGNVMVTPQGTVKVMDFGIARAVSDSAATMTSTAAVIGTA
QYLSPEQARGESVDARSDVYSVGCLLYELATGAPPFTGDSPVSVAYQHVREDPRLPSSVN
PAIPPELDAILLKALSKNPANRYQSAADMRSDLLRAMAGQPVEATPVMGDAAKTAIIGAP
PGGYGDVDWDDEDDDAARKRRRNRIIAAVIAGVLVLGGVIAVALLIGSDGEEAPAATPTA
PQVSVPNVAGQDQATATQNLQAAGLTVGTVTTQVTSDESQVDTVLGTDPSSGTQVDQGST
VDLVVGVGPDTVEVPAVIGLDVDRAETTLANAGFDDVQTEEVDSLSPADQVVDVTPGEGQ
SVDPSTTVTLQVSDGTTEVPDVTGQQQAAATQALRSAGFTNVTAEQVESGQPEGTVVATD
PSGGQQASADEPITLQVSAGEEQIPVPNVVGQSEAQARAALQRAGFTNVTVTRTTSDDVQ
QSQVVSTTPAAGTQAAASDPITLLIADPAPDAGTGTDPDTGETPAGG
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgccccaggtgctcggcgagcgctacgagatcggcggggtgctcggtcgcggc
ggcatggccgaggtgcaccgcggccgcgacctgcgcctcggccgcgaggtggcggtcaag
gtgctgcgcagcgacctcgcccgcgacccctccttccaggtccgcttccggagggaggcg
caggccgccgcctcgctcaaccacccggcgatcgtcgccgtctacgacaccggcgaggac
cggtcgtccagcggcgccaccccgtacatcgtcatggagtacgtcgagggcgagaccctg
cgggacgtgctccgccgggagggcgtgctctccccggcgcgggcgatggacttcgcggcc
gacatctgcgccgccctggacttcagccaccgcaacggcatcgtgcaccgcgacgtgaag
cccgggaacgtgatggtcaccccccagggcacggtcaaggtcatggacttcggcatcgcc
cgggcggtgtcggactccgccgcgaccatgacctccaccgccgcggtgatagggaccgcc
cagtacctctcccccgagcaggcccgcggcgagagcgtcgacgcccgctcggacgtgtac
tcggtcggctgcctgctctacgagctcgccaccggcgcgccgcccttcaccggcgactca
cccgtctcggtggcctaccagcacgtgcgcgaggacccgcgcctgccgtcgtcggtgaac
ccggccatcccgccggagctcgacgccatcctgctcaaggcgctgagcaagaacccggcg
aaccggtaccagtcggccgccgacatgcgcagcgacctgctgcgggcgatggccggccag
ccggtcgaggccacgccggtgatgggcgacgccgcgaagaccgccatcatcggcgccccg
cccggcgggtacggcgacgtcgactgggacgacgaggacgacgacgctgcccgcaagcgc
cggcgcaaccgcatcatcgccgccgtcatcgccggagtgctggtcctcggcggcgtgatc
gccgtggcgctgctcatcggctccgacggggaggaggcgccggcggcgaccccgacggcc
ccacaggtctccgtgccgaacgtcgccggccaggaccaggcgacggcgacccagaacctc
caggccgccggcctgaccgtcggcacggtgaccacccaggtcaccagcgacgagtcccag
gtcgacaccgtcctgggcaccgacccgtccagcggcacccaggtcgaccagggcagcacc
gtcgacctcgtcgtcggcgtcgggccggacacggtcgaggtccccgccgtcatcggcctg
gacgtcgaccgcgccgagaccacgctggcgaacgccgggttcgacgacgtgcagaccgag
gaggtcgactcgctctcgcccgccgaccaggtcgtcgacgtcacccccggcgagggtcag
tcggtcgacccgagcacgaccgtgacgctgcaggtgtccgacggcaccaccgaggtgccc
gacgtgaccggtcagcagcaggcggcggccacccaggcgctgcggagcgcgggcttcacc
aacgtcaccgccgagcaggtggagtccggccagcccgagggcaccgtcgtcgcgaccgac
ccctccggcggccagcaggcgtccgcggacgagccgatcaccctgcaggtctccgccggc
gaggaacagatcccggtgcccaacgtcgtggggcagtccgaggcccaggcgcgcgccgct
ctccagcgagccggtttcaccaacgtcacggtcacgcggaccacaagcgacgacgtccag
cagtcccaggtggtgagcaccactccagccgcgggtacgcaggccgctgcgagtgatccg
atcaccctgctgatcgccgaccccgcccccgacgccgggacgggaaccgacccggacacc
ggcgaaacgccagcgggcggctga

DBGET integrated database retrieval system