KEGG   Geodermatophilus obscurus: Gobs_2793Help
Entry
Gobs_2793         CDS       T01163                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
gob  Geodermatophilus obscurus
Pathway
gob00040  Pentose and glucuronate interconversions
gob00051  Fructose and mannose metabolism
gob01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gob00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Gobs_2793
   00051 Fructose and mannose metabolism
    Gobs_2793
Enzymes [BR:gob01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     Gobs_2793
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ADB75423
UniProt: D2S6P9
LinkDB All DBs
Position
complement(2910822..2911892)
Genome map
AA seq 356 aa AA seqDB search
MSAATGTVRGTGGIGPAGTMRASVLRGPGDVVVEERAVPQPGPGEVVVRVSSVGVCGSDT
HYYDHGRIGRFVVESPLVLGHEAAGEVAALGPGVATLAVGQRVSVEPGVPDLTCPQCLAG
RYNLCPDMRFFATPPIDGAFAEYVVVHAAFAHPVPETISDDAAALLEPLSVGIWACRRGR
VGAGSRVLVTGAGPIGLVSVQAALAFGATEVVVSDVNPARLALAQDLGATEVVDARTARV
ADLPRPPQVLLECSGHPAATADAIRALDRAGRAVLVGMGGDELALPLSVVQERELEVTGT
FRYAGTWPTAIALVAAGRIDLDRLVTGSYRLDQAEDALTAGRRDPRSVKVVVHPQT
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcggcgaccgggacggtccgggggaccggaggcatcggtccggcgggcacgatg
cgggcctcggtcctgcgcgggcccggcgacgtggtcgtcgaggagcgggccgtcccgcag
ccgggccccggcgaggtggtggtccgcgtctcctcggtcggggtctgcggatcggacacg
cactactacgaccacggacgcatcggccggttcgtcgtcgagtccccgctggtgctgggg
cacgaggcggcgggggaggtggccgccctcggccccggcgtcgccacgctcgccgtcggg
cagcgggtgtcggtcgagccgggggtgccggacctgacctgcccgcagtgcctggccggg
cgctacaacctctgtcccgacatgcgcttcttcgccaccccgccgatcgacggcgccttc
gccgagtacgtcgtcgtccacgcggccttcgcccacccggtgcccgagacgatcagcgac
gacgccgccgcactgctggaacccctgtcggtcggcatctgggcctgccgcaggggccgg
gtgggtgccggctcccgggtgctggtcaccggggccgggccgatcgggctggtgagcgtc
caggcggcgctggcgttcggcgccaccgaggtcgtggtgtccgacgtcaaccccgcccgg
ctggctctggcccaggacctcggcgccaccgaggtcgtcgacgcccggactgcgcgcgtc
gcggacctgccgcgcccaccccaggtgctgctcgagtgctccggacacccggccgccacc
gcggacgcgatccgcgctctggaccgggcgggccgggccgtgctcgtcggcatgggcggg
gacgagctcgccctgccgctgtcggtggtgcaggagcgcgagctcgaggtcaccggcacc
ttccgctacgccgggacctggccgacggcgatcgcgctggtcgccgccgggcggatcgac
ctcgaccgcctggtcaccggcagctaccgcctggaccaggccgaggacgcactgacggcc
ggccgccgcgacccgcggtcggtgaaggtcgtcgtccacccccagacctga

DBGET integrated database retrieval system