KEGG   Gordonia sp. KTR9: KTR9_4005Help
Entry
KTR9_4005         CDS       T02216                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase-related aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
gor  Gordonia sp. KTR9
Pathway
gor00250  Alanine, aspartate and glutamate metabolism
gor00410  beta-Alanine metabolism
gor00640  Propanoate metabolism
gor00650  Butanoate metabolism
gor01100  Metabolic pathways
gor01120  Microbial metabolism in diverse environments
Module
gor_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:gor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    KTR9_4005
   00650 Butanoate metabolism
    KTR9_4005
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KTR9_4005
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KTR9_4005
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gor01007]
    KTR9_4005
Enzymes [BR:gor01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     KTR9_4005
Amino acid related enzymes [BR:gor01007]
 Aminotransferase (transaminase)
  Class III
   KTR9_4005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AFR50614
UniProt: J9SNT6
LinkDB All DBs
Position
4603490..4604797
Genome map
AA seq 435 aa AA seqDB search
MTASVDSPIRNSQTASLSPALKQATPVVVDTAAGSWIRGTDGRDYLDFTTGIGVTSTGHC
HPHVVAAAQAQCAKVIHAQYTTVIHTPLLELTARLGAVLPAGLDSVFYANSGSEAVEAAI
RLARMATAKPNIIVFQGGFHGRTVAAASLTTAGTRFSAGFSPLMSGVHMAPFPYAYRYGW
DTDTAVDFALRELDYLLQSRVAPNDTAAFLIEPVLGDGGYLPTPPRFLQGLRERADRHGI
LLVLDEVQAGFGRTGRFWGHQHADGLIPDILITAKGLASGFPISAIAAPTALMSKAWPGS
QGGTYGGNAVAAAAAIATLDVIESEGLVENARVRGEQLLAGLREVCAAFPGVGDVRGLGL
MAGIEFVTTDAAGNTTPDAAAALAVQQATTAQGLLSLTCGPSANVVRLIPALVVTAEEID
LGVARFAAALATALG
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccagcgttgactccccgatccgcaacagccagaccgcgtcgctgagcccggcg
ctgaagcaggcgacgcccgtcgtcgtcgacaccgcggcgggttcgtggatccggggtacc
gacggtcgcgactacctcgacttcacgaccggtatcggtgtgaccagcaccggacactgc
cacccgcacgtcgtcgccgccgcacaggcgcagtgcgccaaggtcatccacgcgcagtac
accaccgtcatacacacgccgctcctggagctcaccgctcgtctcggggcggtactgccc
gccggactcgactccgtcttctacgccaactccggttccgaagccgtcgaggccgccatc
cgcctcgcacggatggccaccgcgaaacccaacatcatcgtcttccagggcggatttcac
ggccggacggtcgcggccgccagcctgacgaccgcggggacccgcttctcggcgggcttc
tcgcccctgatgagcggcgtgcacatggcgccgttcccctacgcctaccgatacggctgg
gacaccgacaccgccgtcgacttcgcgcttcgcgagctcgactatctgctccagtcgcgc
gtcgcacccaacgacaccgccgcgttcctcatcgaacctgtcctcggcgacggcggatac
ctgcccaccccaccgcggttcctccagggtctgcgggaacgagccgaccgccacggcatc
ctcctcgtcctcgacgaggtgcaggcgggattcggtcgcaccggcaggttctggggtcac
cagcacgccgacggactgatccccgacatcctcatcaccgccaagggtctggcatccggc
ttcccgatctcggcgatcgcggcgccgacggccctgatgagcaaggcgtggccggggtcg
cagggcggcacgtacggcgggaacgccgtcgcggccgccgccgcgatcgcgaccctcgac
gtgatcgagtccgagggtctcgtcgagaacgctcgcgtacgcggtgagcagctgctcgcc
ggcctgcgagaggtgtgtgcggcgttccccggggtcggggacgtgcgcggcctaggactg
atggccgggatcgagttcgtcaccacggatgccgccgggaacaccacgcccgacgcggcg
gcggcgctcgccgtccagcaggccaccacggcccaggggctgctgtccctcacctgcggg
ccttcggccaacgtcgtgcgtctcatccccgctctggtggtcacggccgaggagatcgac
ctcggtgtcgcccggttcgcggccgcactcgccaccgcgctcggttag

DBGET integrated database retrieval system