KEGG   Gemella sp. oral taxon 928: AXE85_07940
Entry
AXE85_07940       CDS       T04256                                 

Definition
(GenBank) 5'-methylthioadenosine nucleosidase
  KO
K01243  adenosylhomocysteine nucleosidase [EC:3.2.2.9]
Organism
got  Gemella sp. oral taxon 928
Pathway
got00270  Cysteine and methionine metabolism
got01100  Metabolic pathways
got01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:got00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AXE85_07940
Enzymes [BR:got01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.9  adenosylhomocysteine nucleosidase
     AXE85_07940
SSDB
Motif
Pfam: PNP_UDP_1
Other DBs
NCBI-ProteinID: AME10081
UniProt: A0A0X8KN38
LinkDB
Position
complement(1718056..1718739)
AA seq 227 aa
MIALIGAMPEEVAIIRKKIKNLKENKIAHVNFYEGQYENKDIVLMLSLPGKVNAAIATTL
LLDNYDIDYVINIGTCGALQGDMEIGDMIVATEVRHFDVDATEFGYEIGQVPQMPAKYES
DKYLQQLAGEIVLPNHKVHFGLVGTSDSFISNKKIKKNILKNFPTMQVVEMEAAAIAQTC
YQFNTKFIVCRSVSDKAEEGNRVTFDEFLKIAALNSSILTTELIKKL
NT seq 684 nt   +upstreamnt  +downstreamnt
atgatagctttaatcggagcgatgccggaagaagtggcaattattagaaaaaaaattaaa
aatcttaaagaaaataagatagctcatgtcaatttttatgaaggacaatatgaaaataag
gatattgtacttatgctaagtttacccggaaaagttaatgcagcaatagcaacaacgctt
ttacttgataattatgatattgattatgttattaatatcggaacgtgcggtgcattgcaa
ggtgatatggaaataggcgacatgatagtagcgacagaggtaaggcattttgatgttgat
gcaacggaattcggttatgaaataggtcaagtaccgcaaatgccggcaaaatacgaaagt
gataaatatttacaacagttagccggtgagattgtgttgccaaatcataaagttcatttc
ggtttggtggggacatcagactcatttatttctaataaaaaaataaagaaaaatatttta
aaaaattttcctactatgcaggtagtagaaatggaagctgcggcaatagcacaaacttgc
tatcaatttaacactaaatttatagtttgccgtagtgtgagtgataaggcggaagaaggc
aatagagtaacttttgacgaattcttaaaaattgcggcacttaattcgtcaatattaaca
acagaacttataaagaagttgtag

DBGET integrated database retrieval system