Gluconobacter oxydans 621H: GOX0402 Help Entry GOX0402           CDS       T00230                                  Name (GenBank) Cell division inhibitor MinE   KO K03608   cell division topological specificity factor Organism gox  Gluconobacter oxydans 621H Brite KEGG Orthology (KO) [BR:gox00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:gox03036]     GOX0402   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:gox04812]     GOX0402 Chromosome and associated proteins [BR:gox03036]  Prokaryotic type   Chromosome partitioning proteins    Inhibitors of FtsZ assembly     GOX0402 Cytoskeleton proteins [BR:gox04812]  Prokaryotic cytoskeleton proteins   MinD / ParA class of bacterial cytoskeletal proteins    GOX0402 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MinE Motif Other DBs NCBI-ProteinID:  AAW60185 UniProt:  Q5FTW1 LinkDB All DBs Position 422619..422897 Genome browser AA seq 92 aa AA seqDB search MSFLSNIFARRQQSSSVAKDRLQILLAHERGAGEAGESDLIRQLHKEIMEVIARHVAVDQ DKVQIKVDRGSGCSMLEIDVEVPQELSGKRGS NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgagttttctctcaaacatcttcgcccggcgccagcagtccagcagcgtcgccaaggac cgtctgcagatcctgctcgcgcatgaacgcggtgcgggtgaggccggtgagtccgatctg atccgccagcttcacaaggaaatcatggaagtgatcgcgcgccatgtcgccgttgatcag gacaaggtccagatcaaggtcgaccgtggcagcggctgctccatgctcgaaatcgacgtc gaggttccgcaggaactcagcggcaagcggggttcgtga

DBGET integrated database retrieval system