KEGG   Gluconobacter oxydans 621H: GOX1333Help
Entry
GOX1333           CDS       T00230                                 

Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
gox  Gluconobacter oxydans 621H
Brite
KEGG Orthology (KO) [BR:gox00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GOX1333
Enzymes [BR:gox01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     GOX1333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored Glutaredoxin FAD_binding_2 Thi4 HI0933_like AlaDh_PNT_C FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AAW61085
UniProt: Q5FRB1
LinkDB All DBs
Position
1453972..1455543
Genome map
AA seq 523 aa AA seqDB search
MLQDDLKTQMRAYMEYLRDAVVLEATLGTDDRSNEVRGLLEDIASLSPKVTFSDKGHGTR
IPSFVIRRPGTDVQVCFAGLPMGHEFTSLVLALLQVSGHPPKIEADVVAQIRALDGDYHF
ETYFSQSCQNCPDVVQALNAMSVLNPKIHHTAIDGADFQDEVERLGIRSVPQVYLNGEPF
ASGRMEVADILAKLDTASVARSAEKLNDMAPFDVLVLGAGPAGDAAAIYAARKGLRTGLV
AERFGGQVMDTAGIENFISVPETDGPKLSAALEAHVRQYDVQIIASQLAAKLIPAAETGG
LHQIVLESGAVLRSKTVIIATGARWRHLGVPGEDEYRTKGVAYCPHCDGPFYKGRPVVVT
GGGNSGVEAAIDLAGIVSHVTLLQRGAHLKADKVLQDRLLSLPNVTVLTNALTTKIEGDG
KEVTGLTYSDGDGGLHQIKTDGVFVQIGLLPNTEWLKGTLKLSPYGEIVIDDHCGTSVPG
VFAAGDATTVPYKQIVIAMGEGAKASLSAFDYLIRLPVAAKAN
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaggacgacctgaaaacccagatgcgcgcctatatggagtacctgcgtgatgcg
gtcgtgcttgaggcgacccttggcacggatgaccgctccaatgaggtgcgcggtctgctg
gaagatattgccagcctgtctcccaaggtcacgttctcggacaaggggcacggcacccgc
atcccgtccttcgtgatccgccggccgggcacggatgtgcaggtctgctttgccggtctg
ccaatggggcacgagttcacgtctctggtgctggcgctgcttcaggtcagcgggcatccg
cccaagatcgaagcggatgtggttgcgcagatccgcgcgctggacggggactaccatttc
gagacgtatttctcccagtcctgccagaactgcccggatgtagtgcaggcgctcaatgcc
atgagcgtgctgaatccgaagatccatcacacggccatcgatggggcagattttcaggat
gaggtggagcgccttggtatccgctcggtcccgcaggtctatctgaacggtgagcccttt
gcgtcgggccggatggaagtggcggatattctggccaagctggacacggcctccgtggct
cgttcggcggagaagctgaatgatatggccccgttcgacgtgctggtgctcggtgccggg
ccggccggtgatgcggcggcgatctatgccgcacgaaagggcctgcgcacgggcctcgtg
gccgagcggtttggcggtcaggtcatggatacggccgggattgagaacttcatttccgtg
ccggaaactgacggcccgaaactctcggcagcacttgaggcgcatgttcggcagtatgac
gtgcagatcattgcctcgcagctggcagcgaagctgatccccgctgcggaaactggcggt
ctgcaccagatcgtgctggaaagcggagcggtcctgcgctcgaagacggtcattattgcg
actggtgcgcgctggcggcatctgggtgtgccgggtgaggacgagtatcgcaccaagggt
gtggcgtactgcccgcattgcgacggtccgttctataaggggcgtccggttgtggtgacc
ggcggcggcaatagtggcgtggaagcggcgatcgacctggcagggatcgtctcgcatgtc
acgctgctgcagcgcggggcgcatctgaaagccgacaaggtgcttcaggaccggctgctg
agcctgccgaatgtcacggttctgaccaatgccctgactaccaagatcgagggtgacggc
aaggaagtgaccggcctgacctatagtgatggggacggcggcttgcaccagatcaagacg
gatggcgtgttcgtgcagattggtctgctgcccaatacggaatggctgaaggggacgctg
aagctcagcccgtatggcgagatcgttattgacgaccactgcgggacgtctgttccgggc
gtgtttgcggcgggcgatgcgacgaccgtgccgtacaagcagatcgtcattgccatgggg
gagggggcgaaggcttccctgtcggccttcgattatctgatccgtctgccggtagcggcg
aaggcgaactga

DBGET integrated database retrieval system