KEGG   Gluconobacter oxydans DSM 3504: GLS_c08960
Entry
GLS_c08960        CDS       T03563                                 

Gene name
ptsI
Definition
(GenBank) phosphoenolpyruvate-protein phosphotransferase PtsI
  KO
K08483  phosphoenolpyruvate-protein phosphotransferase (PTS system enzyme I) [EC:2.7.3.9]
Organism
goy  Gluconobacter oxydans DSM 3504
Pathway
goy02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:goy00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    GLS_c08960 (ptsI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:goy02000]
    GLS_c08960 (ptsI)
Enzymes [BR:goy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.9  phosphoenolpyruvate---protein phosphotransferase
     GLS_c08960 (ptsI)
Transporters [BR:goy02000]
 Phosphotransferase system (PTS)
  Enzyme I and HPr
   Enzyme I [TC:8.A.7]
    GLS_c08960 (ptsI)
SSDB
Motif
Pfam: PEP-utilizers_C PEP-utilizers PEP-utilisers_N Rpn9_C
Other DBs
NCBI-ProteinID: AHK70806
UniProt: A0A067Z1I9
LinkDB
Position
complement(1002623..1004389)
AA seq 588 aa
MGLGPAGRVEELPLPDITERYSAIGPEAEGVRLDEAIARALHQIEKMRDRLVGLPEEGRE
EIASLLMVYERMLGPSRLLRQVRSRIADEGLCAEAAVSEVTRELALQVSRMAEAVARENN
TQEADANLRLAGEFEEIGRRLVRNLTGISYRAFSSLPPGSVLVAEQLRPADVAMIDPARI
AAVVTQGGGGADHTAILLRALDIPAILAVPNLMAQVQEGEMVVVDGHLGTVTLSPNETEL
RLAAESAQREVKEKRAFGRLKRLPAQLQSGEDIELSANLELPAELPMLMRNGAKGIGLLR
SEFLFGEREDLPDEDGQTEAYRAIVQAMDGRPVTIRVLDWGGEKGRACMRRLGLAEQVAD
GDNPALGLRGVRLLLRVPEVLETQFAAILRAAEPAEGVPPGRVRILLPMVTSSDEIVDAR
EIYDRVVRRLKRKGHTLPDPLPPLGIMVETPAAALTVDTLARHADFMALGTNDLTMYTLA
VDRADSMVADRYSPLHPGVLRLIEAAADSALRARRPISVCGEMASDPRVVALLIGLGLRS
FSMNSASLPRVKRLIRTLTLEDCDQLRRQVMLETDPVVIRDLVRQFAT
NT seq 1767 nt   +upstreamnt  +downstreamnt
atggggcttggccctgccgggcgtgtcgaggaacttccccttcccgacattaccgagcgc
tacagcgccatcgggccggaagccgagggcgtccggttggacgaggcgatcgcccgcgca
cttcaccagatcgaaaagatgcgggaccggctggtcgggctgccggaagagggccgcgag
gaaattgcctccctgctgatggtctatgagcggatgctcggcccgtcgcggctgctacgt
caggttcgcagccgtatcgccgatgagggactgtgcgccgaggccgccgtctcggaagtc
acgcgggaactggcgttgcaggtctcgcgcatggccgaggccgtggcgcgcgagaacaac
acgcaggaagccgatgccaatctgcgtctggcgggtgagttcgaggaaatcggccgccgc
cttgtgcggaacctgaccggcatttcctatcgcgcgttttccagcctgccgcctggctcc
gttctggtggccgagcagctccgtccggccgatgtcgccatgatcgatccggcccggatt
gcggccgtggtgacgcagggcggtggtggggccgatcacacggccatcctgctgcgcgca
ctcgacattcccgccatcctcgccgtgccgaacctcatggcgcaggtgcaggaaggcgag
atggtggtcgtggacgggcatctcggcaccgtcacgctttcccccaacgagaccgaactg
cgtctggcggcggaatccgcacagcgtgaagtcaaggaaaagcgggctttcgggcgtctc
aagcgcctgcctgcccagcttcagagtggcgaggacatcgagctttccgccaatctggag
cttccggcggaactgccgatgctgatgcgcaatggcgccaagggcatcggcctgctgcgc
agcgaattcctgttcggcgaacgcgaggacctgccggacgaagacggccagaccgaggcc
tatcgcgccatcgtccaggccatggacgggcgtcccgtgacgatccgcgtgctggactgg
ggcggcgagaagggccgggcctgcatgcgacggctgggtctggcggagcaggttgcggat
ggcgacaatcccgcgctgggtctgcggggtgtgcggcttctgctccgtgtgccggaggtg
ctggaaacgcagttcgcggctattctgcgggccgccgagcctgccgagggcgtgcccccc
ggccgggtgcggatcctgctgccgatggtcacgtcgtcggacgaaatcgtggacgcccgc
gagatttacgaccgcgtggtgcgccgcctcaagcgcaagggacatacgctccccgatccg
ttgcccccgctggggatcatggtcgagactccggccgcggccctcacggtggacacgctg
gcccgacacgccgatttcatggcgctcggcaccaatgacctgacgatgtacacgcttgcc
gtggaccgtgcggattccatggtggcggaccgctacagcccgctccatcccggtgtgctg
aggctgattgaggcggctgcggattcggcgctgcgggcgcgtcgtccgatctcggtctgt
ggcgagatggcgtccgatccccgggtggtggcgctgctgatcggcctgggtctgcgctcc
ttttccatgaattccgcctccctgccgcgcgtgaaacgcctgatccgcaccctcacgctc
gaagactgcgaccagctgcgccggcaggtcatgctggaaaccgacccggtcgtgatccgc
gatctggtgcggcagttcgcgacctga

DBGET integrated database retrieval system