KEGG   Gluconobacter oxydans DSM 3504: GLS_c14670Help
Entry
GLS_c14670        CDS       T03563                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
goy  Gluconobacter oxydans DSM 3504
Brite
KEGG Orthology (KO) [BR:goy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GLS_c14670 (ahpF)
Enzymes [BR:goy01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     GLS_c14670 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored Glutaredoxin FAD_binding_2 Thi4 HI0933_like AlaDh_PNT_C FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AHK71355
UniProt: A0A067Z6Q9
LinkDB All DBs
Position
1688101..1689672
Genome map
AA seq 523 aa AA seqDB search
MLQDDLKTQMRAYMEYLRDAVVLEATLGTDDRSNEVRGLLEDIASLSPKVTFSDKGHGTR
IPSFVIRRPGTDVQVCFAGLPMGHEFTSLVLALLQVSGHPPKIEADVVAQIRALDGDFHF
ETYFSQSCQNCPDVVQALNAMSVLNPKIHHTAIDGADFQDEVERLGIRSVPQVYLNGEPF
ASGRMEVADILAKLDTASVARSAEKLNDMAPFDVLVLGAGPAGDAAAIYAARKGLRTGLV
AERFGGQVMDTAGIENFISVPETDGPKLSAALEAHVRQYDVQIIASQLAAKLIPAEETSG
LHQIVLESGATLRSKTIIIATGARWRHLGVPGEDEYRTKGVAYCPHCDGPFYKGRPVVVT
GGGNSGVEAAIDLAGIVSHVTLLQRGAHLKADKVLQDRLLSLPNVTVLTNALTTKIEGDG
KEVTGLTYSDGDGGLHQIKTDGVFVQIGLLPNTEWLKGTLKLSPYGEIVIDDHCATSVPG
VFAAGDATTVPYKQIVIAMGEGAKASLSAFDYLIRLPVAAKAN
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaggacgacctgaaaacccagatgcgcgcctatatggagtacctgcgtgatgcg
gtcgtgcttgaggcgacccttggcacggatgaccgctccaatgaggtgcgcggtctgctg
gaagatattgccagtctgtctcccaaggtcacgttctcggacaaggggcacggcacccgc
atcccgtccttcgtgatccgccggccgggcacggatgtgcaggtctgctttgccggtctg
ccgatggggcacgagttcacgtccctggtgctggcgctgcttcaggtcagcgggcatccg
ccgaagatcgaagcggatgtggttgcgcagatccgcgcgctggacggggacttccatttc
gagacgtatttctcccagtcctgccagaactgcccggatgtggtgcaggcgctcaatgcc
atgagtgtgctgaatccgaagatccatcacacggccatcgatggggcagatttccaggat
gaggtggagcgcctcggcatccgctcggtcccgcaggtttatctgaacggtgagcctttt
gcgtcgggccggatggaggtggcggatattcttgccaagctggatacggcatctgttgcc
cgttcggcggaaaagctgaacgatatggcgccgttcgatgtgctggtacttggtgcgggg
ccggccggtgatgcggcggcgatctatgccgcacgaaagggtctgcgcacgggcctcgtg
gccgagcggtttggcggtcaggtcatggatacggccgggatcgagaacttcatttccgtg
ccggaaacggacggcccgaaactctcggcagcacttgaggcgcatgtccggcagtatgac
gtgcagatcattgcttcgcagcttgcggcgaagctgatcccggctgaggaaaccagcggg
ctgcaccagatcgtgctggaaagcggggcaaccctgcgctcgaagacgatcattattgcg
accggtgcgcgctggcggcatctgggtgtgccgggtgaggacgagtatcgcaccaagggt
gtggcgtactgcccgcattgcgacggcccgttctacaaggggcgtccggttgtggtgacc
ggcggtggcaatagcggcgtggaagcggcgatcgaccttgcggggatcgtctcgcatgtc
acgctgttgcagcgcggcgcgcatctgaaagccgacaaggtgcttcaggaccggctgctg
agcctgccgaatgtcaccgttctgacgaacgccctgaccacgaagatcgagggtgacggc
aaggaagtcaccggcctgacctatagcgacggcgatggtggactgcatcagatcaagacg
gatggcgtgttcgtgcagatcggtctgctgcccaatacggaatggctgaaggggacgctg
aagctcagcccgtatggcgagatcgtcattgacgaccactgcgcgacgtctgttccgggc
gtgtttgcggcgggcgatgcgacaaccgtgccgtacaagcagatcgtcattgccatgggc
gaaggcgccaaggcgtccctgtcggccttcgattatctgatccgtctgccggtggcggcg
aaggcgaactga

DBGET integrated database retrieval system