KEGG   Gordonia polyisoprenivorans: GPOL_c34900Help
Entry
GPOL_c34900       CDS       T01719                                 

Definition
(GenBank) zinc-binding alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
gpo00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:gpo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    GPOL_c34900
Enzymes [BR:gpo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     GPOL_c34900
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     GPOL_c34900
    1.1.1.-  
     GPOL_c34900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AFA74502
UniProt: H6N050
LinkDB All DBs
Position
3925398..3926477
Genome map
AA seq 359 aa AA seqDB search
MRAARYYDRGDIRIEDIDEPTVEPGTVAIDVAWCGICGTDLHEYADGPIFIPPSGHPQPI
SGESAPITLGHEMSGVVSAVGDGVEDLAPGDHVVVEPYIIADGVDTGPDSHNYHLSADMN
FIGLGGRGGGLGEKIVVERRWVHKVSKDIPLDQAALIEPLSVGFHAVQRSGAGAGDVALI
TGAGPIGLLTAAVCKAEGITTIVSEPSRLRREKARDTGVGDHIVDPSTQDVVQVVRDLTD
GRGADVGFECTSVQPALDTLFDALKPTGVLVVVSIWGHPGTLDMQKLVLKEIDMRGTIAY
VNSHPATIRLVEEGKVDLAPFITGRIGLDQLLDEGFDTLLHHNETAVKILVSPSGAGVR
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcagcacgctattacgaccgtggggacatccggatcgaggacatcgacgagccc
accgtcgagcccggaacggtcgccatcgacgtggcgtggtgtgggatctgcggcaccgac
ctgcacgagtacgccgacgggcccatcttcatcccgccgtcggggcatccgcagccgatc
agcggcgagagcgcgccgatcacgctgggacacgagatgtcgggcgtggtctcggcggtc
ggcgacggtgtcgaggacctcgcgccgggcgatcacgtcgtcgtggagccctacatcatc
gccgacggcgtcgacaccggcccggacagccacaactatcacctctcggccgacatgaat
ttcatcgggctcggtggtcgcggcggtggtctcggcgagaagatcgtcgtcgagcgacgc
tgggtccacaaggtgtccaaggacattcccctcgaccaggcggcgttgatcgaacccctg
tcggtgggtttccacgcggtgcaacgcagtggcgccggtgccggggacgtcgcgttgatc
accggagccggcccgatcggtctgctcaccgcagcggtgtgcaaggccgaaggcatcacc
acgatcgtcagcgaaccgagtcggctgcgccgggagaaggcacgtgacaccggcgtcggt
gaccacatcgtcgacccgtcgacgcaggacgtggtgcaggtcgtccgcgacctcaccgac
ggtcgcggcgccgacgtcggcttcgaatgcacctcggtgcaacctgccctcgacaccctc
ttcgatgcactcaagccgacgggagtccttgtggtggtgtcgatctggggtcaccccgga
acgctcgacatgcagaagctggtgctcaaggagatcgacatgcgcggcaccatcgcctat
gtcaacagtcatccggcgaccatccggctcgtcgaggagggcaaggtcgatctcgcaccc
ttcatcaccgggcgcatcggactcgaccagcttctcgacgagggcttcgacacgttgttg
caccacaacgaaaccgcggtgaagatcctggtgtcgccgtccggtgcgggcgtgcgctga

DBGET integrated database retrieval system