KEGG   Gracilibacillus sp. SCU50: GI584_04070Help
Entry
GI584_04070       CDS       T06279                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
grc  Gracilibacillus sp. SCU50
Brite
KEGG Orthology (KO) [BR:grc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GI584_04070 (ahpF)
Enzymes [BR:grc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     GI584_04070 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 FAD_oxidored Thioredoxin_3 HI0933_like DAO Thi4 AlaDh_PNT_C NAD_binding_8 FAD_binding_3 Thioredoxin_4 K_oxygenase Glutaredoxin FMO-like
Motif
Other DBs
NCBI-ProteinID: QGH33265
UniProt: A0A5Q2TF13
LinkDB All DBs
Position
complement(810142..811668)
Genome map
AA seq 508 aa AA seqDB search
MLDQEIKTQLNEYLKLLENDIVIKTSIGSDDVSKEVDELVNEIASMSDKIKVEKSSFDRT
PSFSVNRPGEDTGVIFAGVPLGHEFTSLILALLQVSGRPPKVDDSIIEQIKKLEGPLHFE
TYVSLSCQKCPDVVQALNIMSVVHPEITHTMVEGSAFKEEVDSKDIMAVPSVYLNGEQFV
DGRQTIESILEALGSSADISELNDKDPYDVLVVGGGPAGSSAAIYAARKGIRTGIVAERF
GGQVQDTLGIENFITTTYTEGPKLVANMEEHVRDYNVDIMNSMRAKSLEKKDLFELELEN
GATLKSKTVVLSTGARWRNIGVPGEAEFKNKGVAYCPHCDGPIFEGKDVAVIGGGNSGVE
AAIDLAGIVKHVTLIEFAPELKADNVLQDRLYSLPNVTVHTNARTSEIYGSDKVEGLRYI
DRETEEEKTIELAGVFIQIGLVPNTEWLKDTVEVNKFGEIVVDDHGTTSIPGVFAAGDCT
NSAYKQIIISMGSGATAALGAFDHLIRN
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgcttgatcaagaaataaaaacacagcttaatgaatatttgaaactgttagaaaatgat
attgtcattaagacaagcattggttctgacgatgtttcaaaagaagtagacgaacttgta
aatgaaattgcaagcatgtctgataaaatcaaagtggagaaaagctcatttgatcgtact
ccaagttttagtgtcaatcgtccaggtgaggacaccggtgttattttcgctggagttcca
cttggtcatgagttcacttcacttatattagctctattacaagtgagtggacgcccacca
aaagtggatgattctattattgaacaaatcaaaaaattagaaggtccacttcactttgaa
acatatgtaagtttatcttgtcaaaaatgtcctgatgtcgttcaagcacttaacattatg
agtgtcgtacatcctgaaatcacccatacgatggtagaaggatctgcttttaaagaagaa
gtagatagtaaagacatcatggctgttccttccgtttatttaaatggcgaacagtttgtc
gatggtcgacaaacgattgaaagcatcctcgaagcattaggaagcagcgcggacatttct
gagttaaatgataaagatccttatgatgtattagtagttggtggaggtcctgctggttcc
agtgctgccatttatgctgctcgtaaaggtatccgcactggtattgtagccgaacgattt
ggtggtcaagtacaagatacacttggtatagaaaacttcatcactacaacttatacggaa
ggtcctaagcttgtcgctaacatggaagaacatgtacgtgattataatgtggatatcatg
aactcgatgcgtgcgaagtctttagagaaaaaagacctttttgagctggaattagaaaac
ggtgcaacacttaaaagtaaaaccgttgtgctttcaactggtgctcgctggcgtaatatc
ggtgttcctggtgaagcagaattcaaaaataaaggtgttgcatactgtccccactgtgat
ggtccaatctttgaaggaaaagatgttgccgtaattggtggtggaaactctggggtcgaa
gcagcaattgacttagcaggtattgttaaacacgttacattaattgaatttgctccagaa
ctaaaagcagataacgttttacaggatcgtttatatagcttacccaacgtaacggtgcat
acaaacgcaaggacttctgaaatctatggttctgacaaagtggaaggccttcgatatata
gaccgtgaaacagaagaagaaaaaacaattgaacttgcaggtgtcttcattcaaattggt
ctcgtaccaaatacagaatggctaaaagatacagttgaagtaaataaatttggcgaaatc
gttgtggatgatcatggtacaacaagtatccctggtgtatttgcagcaggtgactgtacg
aacagcgcttataagcaaatcattatttcaatgggatcaggtgctactgcggcattgggc
gcattcgatcatttaattcgaaattaa

DBGET integrated database retrieval system