Glycine soja (wild soybean): 114418169 Help Entry 114418169         CDS       T06057                                  Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism gsj  Glycine soja (wild soybean) Pathway gsj04136   Autophagy - other Brite KEGG Orthology (KO) [BR:gsj00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     114418169  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gsj04131]     114418169    04121 Ubiquitin system [BR:gsj04121]     114418169    03029 Mitochondrial biogenesis [BR:gsj03029]     114418169 Membrane trafficking [BR:gsj04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     114418169 Ubiquitin system [BR:gsj04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    114418169 Mitochondrial biogenesis [BR:gsj03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     114418169 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 DUF4264 EstA_Ig_like Motif Other DBs NCBI-GeneID:  114418169 NCBI-ProteinID:  XP_028239190 LinkDB All DBs Position 7:3150950..3153978 Genome browser AA seq 94 aa AA seqDB search MSSELPSSVRKVVVHLRATGDAPILKQSKFKIAGTDKFAKVIDFLRRQLHRETLFVYVNS AFSPNPDELVIDLFNNFGFDGKLVVNYACSMAWG NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgtcttctgaattgccaagttctgttcgcaaagtggttgttcatctcagagccaccggc gatgctcctatcctcaagcaatccaaattcaagatagcaggaactgataaatttgctaaa gtgatagactttcttcgccgacagctccacagggagacattgtttgtatatgtcaatagt gccttttcaccaaaccctgatgaattggtcattgatttgtttaataattttggctttgat ggcaaactggtggtcaactacgcttgttccatggcatggggctaa

DBGET integrated database retrieval system