Geobacillus thermodenitrificans: GTNG_3000 Help Entry GTNG_3000         CDS       T00496                                  Name (GenBank) Preprotein translocase subunit   KO K03075   preprotein translocase subunit SecG Organism gtn  Geobacillus thermodenitrificans Pathway gtn02024   Quorum sensing gtn03060   Protein export gtn03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:gtn00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     GTNG_3000  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     GTNG_3000  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     GTNG_3000  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:gtn02044]     GTNG_3000 Secretion system [BR:gtn02044]  Sec (secretion) system   Prokaryotic Sec-SRP core components    GTNG_3000 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SecG DUF3852 Rhomboid MatE Motif Other DBs NCBI-ProteinID:  ABO68345 UniProt:  A4ISP1 LinkDB All DBs Position complement(3096955..3097191) Genome browser AA seq 78 aa AA seqDB search MHALLVTLLVIVSIALIAIVLLQSGRSAGLSGAITGGAEQLFGKQKARGLDAVFQRVTVV LAILYFVLTILVAYVQPS NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgcatgccttgcttgtgacgttgcttgtcattgtatcgattgcgctgattgcgattgtg ttgttgcagtcaggccgaagcgcagggctgtcgggggcgattaccggcggtgccgaacag ctgtttggcaaacagaaagcgcgcgggcttgatgcagtgtttcagcgcgtgacggtcgtg ttggccattttgtattttgtgctgacgattctcgtcgcatatgtccaaccatcataa

DBGET integrated database retrieval system