KEGG   Gloeophyllum trabeum: GLOTRDRAFT_124498Help
Entry
GLOTRDRAFT_124498 CDS       T03130                                 

Definition
(RefSeq) hypothetical protein
  KO
K02358  elongation factor Tu
Organism
gtr  Gloeophyllum trabeum
Brite
Translation factors [BR:gtr03012]
 Eukaryotic Type
  Elongation factors
   GLOTRDRAFT_124498
 Prokaryotic Type
   GLOTRDRAFT_124498
Mitochondrial biogenesis [BR:gtr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    GLOTRDRAFT_124498
Exosome [BR:gtr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   GLOTRDRAFT_124498
  Exosomal proteins of breast cancer cells
   GLOTRDRAFT_124498
  Exosomal proteins of colorectal cancer cells
   GLOTRDRAFT_124498
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-GeneID: 19301100
NCBI-ProteinID: XP_007861589
JGI: Glotr1_1_124498
UniProt: S7S1U1
LinkDB All DBs
Position
Unknown
AA seq 457 aa AA seqDB search
MFRSQLATVNAVARRFQSSLGFSTCSRRSTLPSPPLASTSKTTLSWVARRSYADAASSKF
SRAKPHMNIGTIGHVDHGKTTLTAAITKVLAEKGGAKFTDYSQIDKAPEEKARGITINSA
HVEYETDARHYGHIDCPGHADYIKNMITGAAQMDGAIIVVSATDGQMPQTREHLLLARQV
GIKKLVVFINKVDQIDDKEMLELVEMEMRDLLSTYNFEGDHTPIIMGSALAALEGRNPEI
GAEKIKELVKACDEWLEIPPRDLEKPFLMPIEDVFSISGRGTVCTGRVERGTINKGDEVE
VLGLGENIKTTVTGIEMFHKELDRGEAGDNMGCLLRGVKREQIRRGMVVIQPGSMKSVKK
FQAQIYVLTKDEGGRYTPFMQNYRPQLFLRTADITVSLTFPEGTADAAEKMVMPGDNVEM
VLDLVHDVAAEVGSRFTLREGNKTIGTGIVTKILELA
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgttccgttcgcagctggcgaccgtgaacgccgttgctcgcaggttccagagctcgcta
gggttctcgacatgttcgcggcggtcgacgctgccttcgccaccgctggcttctaccagc
aagacgactcttagttgggtcgctcgccgcagctatgcagatgcagcctcctcgaagttc
tctcgagcaaaacctcacatgaacatcgggactatcggacatgttgatcatggaaagaca
acgctaaccgctgccattactaaagtccttgctgagaagggcggcgccaaattcacggac
tactcccagattgataaggcgccagaggagaaggctcgtggtatcacgatcaattccgca
cacgtagaatacgagacggatgcccggcattatggtcacatcgactgtccaggacacgct
gattacatcaagaacatgattactggtgctgcacagatggacggcgctatcatcgtggtt
tctgccactgacggtcaaatgccccaaactcgtgaacatctgctccttgctcgtcaagtc
ggaatcaaaaagctcgttgtcttcatcaacaaggttgaccagatcgatgacaaggaaatg
ctggaactcgtggaaatggagatgcgtgacctcctctcgacgtataacttcgagggtgac
cacacgccgattatcatgggctccgctcttgctgctttggaaggtcgcaacccggagatc
ggcgctgagaagatcaaggaattggtcaaggcctgcgacgaatggcttgagatccctcct
cgtgatctcgagaagcccttccttatgcccattgaagacgtcttctctatctctggtcgt
ggtaccgtttgcactggtcgggttgagcgtggcactatcaacaagggtgacgaagtagag
gttcttggtctgggcgagaacatcaagacgactgtcactggcatcgagatgttccacaag
gagttggatcgtggagaggctggtgacaacatgggctgcttgctccgtggtgtcaagcgc
gagcagattcgccgtggaatggttgtcatccagcctggctccatgaagtctgtcaagaaa
ttccaggctcagatctacgttttgactaaagacgagggtggtcgctacactcctttcatg
cagaactatagaccccagctcttcttacggacggccgacataacggtttcgttgactttc
cctgaaggtaccgcggacgccgcggagaagatggttatgcctggggacaatgtcgagatg
gtgctcgaccttgttcacgacgtcgctgccgaagttggctcaaggttcactctccgtgag
ggtaacaagacgatcggtactggcattgtcaccaaaatcctggaacttgcataa

DBGET integrated database retrieval system