KEGG   Komagataeibacter medellinensis: GLX_02820Help
Entry
GLX_02820         CDS       T01631                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
gxy  Komagataeibacter medellinensis
Pathway
gxy00473  D-Alanine metabolism
gxy01100  Metabolic pathways
gxy01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:gxy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    GLX_02820
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    GLX_02820
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gxy01011]
    GLX_02820
Enzymes [BR:gxy01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     GLX_02820
Peptidoglycan biosynthesis and degradation proteins [BR:gxy01011]
 Precursor biosynthesis
  Racemase
   GLX_02820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: BAK82694
UniProt: G2I389
LinkDB All DBs
Position
complement(334634..335779)
Genome map
AA seq 381 aa AA seqDB search
MTNLPFPTPATGWAAPGAGAMLEISLGAIAANYRLLNARAGQATCAAVVKADAYGLGAHK
VAPVLEQAGAKVFFVAHLEEGIRLRAHVSPAAEIFVLHGPMPGTEQEFTRHALLPVLNSM
EQIAGWHAHATQTQQALPAAIQVDTGMSRFGLSEADVAILAATPALLEGIDTRLVMSHLA
CADTPDNPANAMQRDRLRAMAALLPAAPLALSASSGIFLGPDYHFDLVRPGAALYGLAPN
ADAPNPLHPTVRLQARIVQRRTIGAGNGVGYGLTWRASGPKRIATLGIGYADGFLRQGAN
NGGCAWLDSYRLPILGRISMDSTTIDVSDVPESVLDQITHVDMIGPHRSVDDVAHSAGTI
GYEVLTALGSRFHRAYLPQVA
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacctgccttttcccacgcccgccaccgggtgggcagcacccggcgccggggcc
atgctggaaatcagccttggtgccatcgcggccaattaccggctactcaatgcacgcgcc
ggacaggcgacctgcgccgccgtagtcaaggccgatgcttacggtctgggggcgcacaag
gtggccccggtgctggaacaggcgggggcgaaggtctttttcgtcgcccatctggaagaa
ggtatccgcctgcgcgcccatgtcagccctgcggcggaaatttttgtcctccatggtccc
atgcccggtacggagcaggaattcacccgccatgccctgttgcccgtgctcaacagcatg
gagcagattgcgggctggcatgcacatgcgacacagacccagcaggccctgcccgcagcc
atacaggttgataccggcatgtcgcgctttggcctgtcggaagcggatgtggcgatactg
gccgccacccctgccctgctggagggcattgatacccgtctggtcatgagccaccttgcc
tgcgctgatacacctgacaaccccgccaatgccatgcagcgcgaccggttgcgcgccatg
gcggccctgctgccagcggccccgctggcactttcggcctcatcgggcatctttctgggg
ccggattaccattttgacctggtgcggccgggcgcagccctttacggccttgcccccaac
gccgacgctcccaacccgctccaccccaccgtgcggttgcaggcacggatcgtgcagcgc
cgcaccatcggcgcgggcaatggcgtgggttatggcctgacatggcgcgccagcggacca
aaacgcattgccacgctgggcataggctatgccgatggcttcctgcgccagggtgccaat
aatggcggctgtgcatggctggacagctaccgcctaccgattttgggccggatttccatg
gattccacgaccattgacgtaagcgacgtacccgaaagcgtgctggaccagataacccat
gtggacatgatcggcccccaccgcagcgtggatgacgtggcccattccgcaggcaccatc
ggctatgaagtgctgacggcactcggctcgcgtttccatcgcgcctacctgccacaggta
gcgtga

DBGET integrated database retrieval system