KEGG   Hipposideros armiger (great roundleaf bat): 109374968Help
Entry
109374968         CDS       T04661                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin-endoperoxide synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai00590  Arachidonic acid metabolism
hai01100  Metabolic pathways
hai04611  Platelet activation
hai04726  Serotonergic synapse
hai04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:hai00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    109374968 (PTGS1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109374968 (PTGS1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    109374968 (PTGS1)
  09156 Nervous system
   04726 Serotonergic synapse
    109374968 (PTGS1)
Enzymes [BR:hai01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     109374968 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF hEGF
Motif
Other DBs
NCBI-GeneID: 109374968
NCBI-ProteinID: XP_019485575
LinkDB All DBs
Position
Un
AA seq 604 aa AA seqDB search
MSRRSLSLRFPLLLLLLLLLLPPPPVLAADPREPAPVNPCCYYPCQHQGICIRFGLDRYQ
CDCTRTGYSGPNCTIPELWTWLRNSLRPSPSVIHFLLTHGRWFWEFVNATFIRDMLMRLV
LTARSNLIPSPPTYNAAYDYISWESFSNVSYYTRILPSVPQDCPTPMGTKGKKQLPDAQL
LSRRLLLRRTFIPDPQGSSLMFAFFAQHFTHQFFKTSGKKGPGFTNALGHGVDFGHVYGD
NLDRQYQLRLFKDGKLKYQVLDGEMYPPSVEEAHVYMHYPQGIPPQSQMAVGQEVFGLLP
GLMLYATLWLREHNRVCDLLKAEHPTWDDEQLFQTARLILIGETIKIVIEEYVQQLSGYF
LQLKFDPELLFSSQFQYSNRIAMEFNQLYRWHPLMPDSFKVGAQEYSYKQFLFNTSMLVD
YGVEALVDAFSHQRAGRIGGGRNLDPHVLHVALDVIKESRELRLQPFNEYRKRFGMKPYT
SFQEFTGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGSPFSLKGLLG
NPICSPEYWKSSTFGGEMGFNIVKTATLKKLVCLNTKTCPYVSFRVPDPHQDDGPGVERP
STEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgagccggcggagtctctcgctccggttcccgctgctcctgctgctgctgttgctgttg
ctgccgccgcccccggtcctagctgcggaccccagggagcccgctccggtgaacccttgt
tgttattacccatgccagcaccagggcatctgcatccgctttggccttgaccgttaccag
tgtgactgcacccgcacgggctattccggccccaactgcaccatccctgagctgtggacc
tggctccggaattcattgcgacccagcccctctgtcatccacttcctgctgacacacggg
cgctggttctgggagtttgtcaatgccaccttcatccgggacatgctcatgcgcctggta
ctcacagcacgttccaaccttatccctagcccccccacctacaacgcggcatatgactac
atcagctgggagtccttctccaatgtgagctattacactcgtattctgccctccgtgccc
caagactgccccacgcccatggggaccaaagggaagaagcagttgccagatgcccagctc
ctgagtcgccgcttgctgctcaggaggacgttcatacccgacccccaagggagcagtctc
atgtttgccttctttgcacaacactttacccaccagttcttcaaaacctctggcaagaag
ggtcctggcttcaccaatgccttgggccatggggtagactttggccatgtttatggagac
aatctggaccgtcagtatcagttgcggctctttaaggatgggaaactcaagtaccaggtg
ctggacggagagatgtacccgccatcggtggaagaggcgcatgtgtatatgcactaccca
cagggcattccgccccagagccagatggctgtgggccaggaagtgtttggactgcttcct
gggctcatgctctatgccaccctctggctgcgcgagcacaaccgtgtgtgtgacctgctg
aaggctgagcaccccacctgggacgatgagcagctcttccagacggcccgcctcatcctt
atcggtgagaccatcaagattgtgattgaggagtacgtgcaacagctgagtggctacttc
ctgcagctcaagttcgacccggagctgctattcagctcccagttccagtacagtaatcgt
attgccatggagttcaaccagctgtaccgctggcacccgctcatgcccgactccttcaag
gtgggtgcccaggagtacagctacaagcagttcctgttcaacacctccatgctggtggac
tatggggtcgaggccctggtggacgccttctctcaccagagggccggccggatcggtggg
ggtaggaatttagatcctcatgtcctgcacgtggccttggatgtcatcaaggaatctcga
gagctgcggctgcagcccttcaatgagtaccgcaagaggtttggcatgaaaccctacacc
tctttccaggagttcacaggagagaaggagatggcagctgagttggaagagctctatgga
gacatcgatgccttggagttctacccgggactgcttcttgagaagtgccatccaaactcc
atctttggggagagtatgatagaaatcggatctcccttttccctcaagggcctcttaggg
aaccccatctgttctccagaatattggaagtcgagcacatttggtggcgagatgggcttc
aacattgtcaaaacagccacactgaagaaactggtgtgcctcaacacgaagacgtgtccc
tacgtttccttccgtgtgcccgacccccaccaggatgatggccctggtgtggagcggcca
tccacagagctctga

DBGET integrated database retrieval system