KEGG   Hipposideros armiger (great roundleaf bat): 109376220
Entry
109376220         CDS       T04661                                 

Gene name
KITLG
Definition
(RefSeq) KIT ligand
  KO
K05461  KIT ligand
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04010  MAPK signaling pathway
hai04014  Ras signaling pathway
hai04015  Rap1 signaling pathway
hai04072  Phospholipase D signaling pathway
hai04151  PI3K-Akt signaling pathway
hai04640  Hematopoietic cell lineage
hai04916  Melanogenesis
hai05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109376220 (KITLG)
   04014 Ras signaling pathway
    109376220 (KITLG)
   04015 Rap1 signaling pathway
    109376220 (KITLG)
   04072 Phospholipase D signaling pathway
    109376220 (KITLG)
   04151 PI3K-Akt signaling pathway
    109376220 (KITLG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109376220 (KITLG)
  09152 Endocrine system
   04916 Melanogenesis
    109376220 (KITLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109376220 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hai04052]
    109376220 (KITLG)
Cytokines and growth factors [BR:hai04052]
 Growth factors
  Growth factors (RTK binding)
   109376220 (KITLG)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 109376220
NCBI-ProteinID: XP_019487582
LinkDB
Position
Un
AA seq 275 aa
MKKTQTWIITCIYLQLLLFNPFVSTTGICMNRITDDVKDVTKLVANLPKDYKIALKYVPG
MDLLPSHCWISEMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECMEGRRP
FENVKKSSKSLESKLFTPKEFFRIFNRSIDAFKDLEMVSSKTNECAVSLTLSPEKDSRVS
VTKPFMLPPVAANSLKNDSSSSNRKTSNSIGDSNLQWVAMALPAFFSLVIGFGFGALYWK
KKQSNHTRAVENIQINEEDNEISMLQEKEREFQEV
NT seq 828 nt   +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattatcacttgcatttatctacaactgctcctatttaac
cctttcgtcagcactacagggatctgcatgaaccgtataactgatgatgtgaaagacgtt
acaaaattggtggcaaatcttccaaaagactataagatagcactcaaatatgtccctgga
atggaccttttgcctagtcattgttggataagtgaaatggtggaacaattgtcagtcagc
ttgactgatcttctggacaagttttcaaatatttctgaaggcttgagtaattattctatc
atagacaaactggtgaaaatagtggatgaccttgtggagtgcatggaaggacgacgccca
tttgagaatgtaaaaaaatcatctaagagcctcgaatccaagctgtttactcccaaagaa
ttctttagaatttttaatagatccatcgatgccttcaaggacttggagatggtgtcatct
aaaactaatgaatgtgcggtttctttaacattaagccctgaaaaagattccagagtcagt
gtcacaaaaccatttatgttaccccctgttgcagccaactcccttaagaatgacagcagt
agcagtaataggaagacctcaaattccattggagactccaacctacaatgggtagctatg
gcgttgccggcattcttttctcttgtaattggatttggttttggagccttatactggaag
aagaaacaatcaaatcatacaagagcagttgaaaatatacagattaatgaagaggataat
gagataagtatgttgcaagaaaaggagagagagtttcaagaagtgtaa

DBGET integrated database retrieval system