KEGG   Hipposideros armiger (great roundleaf bat): 109377395
Entry
109377395         CDS       T04661                                 

Gene name
NLRP3
Definition
(RefSeq) NLR family pyrin domain containing 3
  KO
K12800  NACHT, LRR and PYD domains-containing protein 3
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04217  Necroptosis
hai04621  NOD-like receptor signaling pathway
hai04625  C-type lectin receptor signaling pathway
hai05132  Salmonella infection
hai05133  Pertussis
hai05135  Yersinia infection
hai05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hai00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109377395 (NLRP3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    109377395 (NLRP3)
   04625 C-type lectin receptor signaling pathway
    109377395 (NLRP3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109377395 (NLRP3)
   05135 Yersinia infection
    109377395 (NLRP3)
   05133 Pertussis
    109377395 (NLRP3)
  09172 Infectious disease: viral
   05164 Influenza A
    109377395 (NLRP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hai04131]
    109377395 (NLRP3)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:hai04054]
    109377395 (NLRP3)
Membrane trafficking [BR:hai04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    109377395 (NLRP3)
Pattern recognition receptors [BR:hai04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   109377395 (NLRP3)
SSDB
Motif
Pfam: NACHT NLRC4_HD2 PYRIN LRR_6 NOD2_WH FISNA LRR_4 NB-ARC AAA_16
Other DBs
NCBI-GeneID: 109377395
NCBI-ProteinID: XP_019489267
LinkDB
Position
Un
AA seq 1042 aa
MPQDPDLPPVSMASVRCKLARYLEDLEDVDMKKFKMHLEDYPPQKGCTALPRGQTEKADH
VDLATLMIDFNGEEKAWAMAVWIFAAINRRDLYEKAKRDEPEWDNVHVSVECREESLEEE
WMGLLGYLSRISICKKKEDYCTKYRKHVRSRFQCIKDRNARLGESVNLNKRYTRLRLVKE
YQSQQDREHELLAIGRSSAKTRDSSVSSMNLDLLFEPEDPHSEPVHTVVLQGSAGIGKTI
LARKIMLDWASEKLYKDRFDYLFYIHCREVSLGTQRSLGDLMVSCCPDPNPPIHKIVRRP
SRILFLMDGFDELQGAFDEHMEALCTDWRKVERGDILLSSLIRKRLLPEASLLITTRPVA
LEKLQHLLDRPRHVEVLGFSEAKKKEYFFKYFSDEQQAREAIRLTQENEVLFTMCFIPLV
CWIVCTGLKQQMDSGKSLAQTSKTTTAVYIFFLSSLLHSQGGSQKHHVSANLRGLCSLAA
DGIWNQKILFEESDLRNHGLQKADVSAFLRVNLFQKEVDCETFYNFIHMTFQEFFAAMYY
LLEEEEQQGMKNMPGGRLELPKRDVTVLLENYGKFEKGYLIFVVRFLFGLINQERTSYLE
KKLSCKISQQIRLELLKWIEAKTKAKTLQTQPSQLELFYCLYEMQEEDFVQRAMGHFPKI
KINLSTRMDHVVSSFCIQNYRSVESLSLRLLLYSPKEDEEEEDVGHCLMGQCDPPGPHTV
PSHRLVNCDLTPAFCWGLLSVLSTNQSLTELNLSDNNLGDTGMEVLCEMLQSPGCNIQRL
WLRRCCLSHHCCFTISSALSSNQTLVELDLSHNALADSGVRLLCVGLRHAFCNLQKLWLA
NCGLTSVCCVDLASVLSTSQSLTRLYLGENALGDAGVGILCEKAKHPQCNLQKLGLVNSG
LTSSCCPALSSVLSANQNLTHLYLRGNALGDMGVKLLCKGLLHPNCKLQLLELDDCSLTS
HCCWDLSTLLTSNRSLRQLSLGNNDLGDLGVMMFCEVLKQQGCLLKCLQLCKMCLNYATI
CALETLQEEKPELTIVFEPSQW
NT seq 3129 nt   +upstreamnt  +downstreamnt
atgcctcaggaccctgacctgccgcctgtgagcatggccagcgtccgctgcaagctggcc
cgctacttggaggacctggaggatgtggacatgaagaaattcaagatgcacttagaagac
taccctcctcagaagggctgcacggccctccctcggggtcagacagagaaagcagatcac
gtggacctagccaccttgatgatagatttcaatggggaggagaaggcatgggccatggcg
gtgtggatttttgctgcaatcaacaggagagacctttacgagaaagctaagagggatgag
ccagagtgggataatgtacatgtttctgtggaatgccgggaagaaagcctcgaagaggag
tggatgggtttattggggtacctttccagaatctctatttgtaaaaaaaaggaagattac
tgtacaaaatacagaaaacatgtgagaagcagattccagtgcattaaagacaggaatgcc
cgtctgggtgagagtgtgaacctcaacaagcgctataccaggctgcgtcttgtcaaggaa
taccagagccagcaggacagagagcacgagctcctggccatcggcaggtcttctgccaag
acgcgggacagctctgtgagttccatgaacttggacttgctgtttgagcccgaggaccca
cactctgagcctgtgcacacggtggtgctccaggggtcagcgggcattgggaaaacaata
ctggcccggaagatcatgttggactgggcgtcggagaagctttacaaggacaggttcgac
tacttgttctatatccattgtcgggaggtgagcctcgggacgcagaggagcctgggggac
ctgatggtcagctgctgccctgacccaaacccacccatacacaagattgtgagaaggcct
tccaggatcctcttcctcatggacggcttcgatgagctgcaaggcgccttcgatgagcac
atggaagcactctgcactgactggcggaaggtggagcggggagacattctcctgagcagc
ctcatcagaaagaggctgcttccagaggcttccctgctcatcaccacgagacccgtggcc
ctggagaagctgcagcacttgctggaccgtccgcgacatgtggaggtcctgggtttctca
gaggcgaagaagaaggaatatttctttaagtatttctcagatgagcagcaagccagggaa
gccatcagactgactcaggagaacgaggtcctcttcaccatgtgcttcatccccctggtc
tgctggatcgtgtgcacggggctcaaacagcagatggacagtggcaagagtcttgctcag
acgtccaagaccaccactgcggtgtacatcttcttcctctccagtttgctgcattcgcag
ggagggagccagaagcaccatgtctctgccaacctccggggtctctgctcattggccgca
gatggaatctggaaccagaaaatcctgtttgaggagagtgacctcaggaaccatggcctg
cagaaggcagatgtgtctgctttcctgagggtgaacctattccaaaaggaagtggactgt
gagacattctacaacttcatccacatgactttccaggagttctttgctgccatgtactac
ctgctggaagaggaggaacagcagggcatgaagaatatgccagggggtcgtttggagctt
cccaaacgagatgtgacggtccttcttgaaaactacggcaaatttgaaaaggggtatctg
atttttgttgttcgtttcctctttgggcttataaaccaggagaggacctcatacttggag
aaaaaactcagttgtaagatctctcagcaaatcaggctggagctgctgaagtggattgaa
gccaagaccaaggccaagacgctgcagacccagcccagtcagctggagctgttctattgc
ttgtatgagatgcaggaggaggactttgtgcaaagggccatgggccacttccccaaaatc
aagatcaatctctccaccagaatggaccatgtggtttcttctttttgtatccagaactat
cgcagtgtggagtcactttctctgaggctgctcctttactcacccaaggaggacgaggag
gaggaggatgttggacactgtcttatgggccagtgtgaccctccaggtcctcacactgtc
ccttctcatcgattggtgaactgtgatctcactcctgccttctgctggggtctcctctct
gtcctgagcactaaccagagtctcactgaattaaacctcagtgacaataatctgggggac
acagggatggaggtgttatgtgaaatgctccagagtcctggctgtaacattcagagattg
tggttgaggcgctgttgcctttcccatcactgctgcttcaccatctcctcggccctgagc
agcaaccagacactggtggaactggacctgagccacaatgccctggcagacagcggagtc
agacttctgtgtgtgggactgaggcatgcgttctgcaacctgcagaagctctggttggcc
aattgtggcctcacgtcggtgtgctgtgtggatctcgcatccgtcctgagcaccagccag
tccctgaccagactctacttgggggaaaatgccctgggagatgcaggagttggaatttta
tgtgaaaaagcaaagcatccgcagtgtaacctgcagaaactggggttggtgaactctggc
cttacatcatcctgctgtccagctctgtcctcggtgctcagtgctaaccagaatctcaca
cacctgtacctgcggggcaatgctcttggagacatgggtgtcaagctgctctgtaagggc
ctcttgcacccgaactgcaaacttcagttactggaactagatgactgcagtctcacctcg
cactgctgctgggatctgtccacacttctgacctccaaccggagcctgcggcagctgagc
ctgggcaacaatgacctgggggacctgggggtcatgatgttctgcgaggtgctgaaacaa
cagggctgcctcctgaaatgcctgcagttgtgtaaaatgtgtcttaattatgctacaatc
tgcgcattagaaacacttcaagaagaaaagccggagctgactattgtctttgagccttct
cagtggtga

DBGET integrated database retrieval system