KEGG   Hipposideros armiger (great roundleaf bat): 109380254
Entry
109380254         CDS       T04661                                 

Gene name
KPNA2
Definition
(RefSeq) karyopherin subunit alpha 2
  KO
K15043  importin subunit alpha-1/8
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hai00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    109380254 (KPNA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hai03036]
    109380254 (KPNA2)
Chromosome and associated proteins [BR:hai03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    109380254 (KPNA2)
SSDB
Motif
Pfam: Arm IBB Arm_3 HEAT_EZ HEAT_2 HEAT V-ATPase_H_C Gcn1_N ParcG
Other DBs
NCBI-GeneID: 109380254
NCBI-ProteinID: XP_019493181
LinkDB
Position
Un
AA seq 530 aa
MSTNENANSPAARLNRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDA
TSPLQENRNNQGPVNWSVEDIVKSINSNNLENQLQATQAARKLLSREKQPPIDNIIRAGL
IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHPHISE
QAVWALGNIAGDGAVFRDLVIKYGAIDPLLALLAIPDMSSLACGYLRNLTWTLSNLCRNK
NPAPPLDAVEQILPTLVRLLHHDDPEVLADSCWAISYLTDGPNERIEMVVKTGVVPQLVK
LLGAAELPIVTPALRAIGNIVTGTDEQTQVVIDAGALTVFPSLLTNSKTNIQKEATWTMS
NITAGRQDQIQQVVNHGLVPFLISVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCG
IIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHE
NESVYRASLNLIEKYFSVEEEEEDQNVVPETTSDGYAFQVQDGTPGTFKF
NT seq 1593 nt   +upstreamnt  +downstreamnt
atgtccaccaacgagaatgctaattcaccagctgcccgccttaacagattcaagaacaag
gggaaagacagtacagaaatgaggcggcgccgaatagaagttaatgtggagctgaggaaa
gcgaagaaggatgaccagatgctgaaaaggagaaatgtaagctcgtttcctgatgatgct
acttctccactgcaggaaaaccgcaacaaccagggccctgtaaattggtctgttgaggat
attgtcaaaagcataaatagcaacaatttggaaaaccagctccaagctactcaagctgct
aggaaactactttctagggaaaaacagccaccaatagacaacatcatccgggctggtttg
atccccaaatttgtgtccttcttggggagaactgattgtagtcccattcagtttgaatct
gcgtgggccctcactaacattgcttctgggacatcagaacagaccaaggctgtagtagat
ggaggtgctatcccagcattcatttccctgttggcatcgccccaccctcacatcagtgaa
caagccgtatgggctctaggaaacattgcaggtgatggtgcggttttccgagacttggtt
atcaagtatggtgcaattgacccactgttggctcttcttgctattcctgatatgtcatct
ttagcatgtggttacttacgtaatcttacctggacactttcaaacctgtgtcgcaacaag
aaccctgcgcccccattagatgctgttgagcaaattcttcctaccttagttcgtctcctg
catcacgatgatccagaagtgttagctgatagctgctgggccatttcctaccttactgat
ggtccaaatgaacggattgaaatggttgtgaaaacaggagttgtgccccaacttgtgaag
ctcctaggagctgctgaattgccaattgtgacgcctgctctaagagccattggaaatatt
gtcactgggacagatgaacagactcaggttgtcatagatgcaggagcacttaccgtcttt
cccagcctgctaacgaactccaaaacgaacatccagaaggaagccacgtggacaatgtca
aacatcacagctggccgccaagaccaaatacagcaagtggtgaaccatggattagtccca
ttcctcattagcgttctctctaaggcagattttaagacacaaaaggaagctgtatgggct
gtgaccaactatacaagtggtggaacagttgaacagattgtataccttgttcattgtggc
ataatagaaccactgatgaacctcttaactgcgaaagataccaaaattattctggttatt
ctggatgccatttcaaatatctttcaggctgctgagaaactaggcgaaactgagaaactt
agtataatgattgaagaatgtggaggtttggacaaaattgaagctctacaaaaccatgaa
aatgagtctgtgtacagagcttcattaaacttgattgagaagtatttctctgtagaggaa
gaagaggaggatcaaaatgttgtgccagaaactacctctgacggctatgcattccaagtt
caggacggcactcctgggaccttcaagttttaa

KEGG   Hipposideros armiger (great roundleaf bat): 109388210
Entry
109388210         CDS       T04661                                 

Gene name
KPNA1
Definition
(RefSeq) karyopherin subunit alpha 1
  KO
K23940  importin subunit alpha-5
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai05132  Salmonella infection
hai05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hai00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109388210 (KPNA1)
  09172 Infectious disease: viral
   05164 Influenza A
    109388210 (KPNA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hai03036]
    109388210 (KPNA1)
Chromosome and associated proteins [BR:hai03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    109388210 (KPNA1)
SSDB
Motif
Pfam: Arm IBB Arm_3 HEAT_2 HEAT_EZ HEAT V-ATPase_H_C RICTOR_V Arm_2 V-ATPase_H_N FmdE
Other DBs
NCBI-GeneID: 109388210
NCBI-ProteinID: XP_019508269
LinkDB
Position
Un
AA seq 538 aa
MTTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEE
VMSDGGFHEAQINNMEMAPGGVITSDMIEMIFSNSPEQQLSATQKFRKLLSKEPNPPIDE
VISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSS
EFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNCLTMTRNAVWALSNLC
RGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRR
LVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACW
TISNITAGNRAQIQTVIDAKIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLV
ELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDK
IEFLQSHENQEIYQKAFDLIEHYFGTEDEDSSIAPQVDLSQQQYIFQQCEAPMEGFQL
NT seq 1617 nt   +upstreamnt  +downstreamnt
atgactactccaggaaaagagaactttcgcctgaaaagttacaaaaataagtccctgaat
cctgatgagatgcgcaggagaagggaggaagaaggactgcagttacgcaaacagaaaaga
gaagagcagttattcaagagaagaaatgttgctacagcagaagaagaaacagaagaggaa
gttatgtcagatggaggcttccatgaggctcagattaataacatggagatggcaccaggt
ggtgttattacttctgacatgatcgaaatgatattttccaatagcccagagcaacagctt
tcagcaacacagaaattcagaaaactgctttcaaaagaacctaatcctccgattgatgaa
gtcatcagcacaccgggagtagtggccaggtttgtggagttcctcaaacgaaaagagaat
tgtacactgcagtttgaatcagcttgggtattgacaaatattgcttcaggaaattctctt
cagacccggattgtgattcaggcaggagctgtgcctatcttcatagagttgctaagctca
gagtttgaagatgtccaggagcaggcagtctgggctcttggcaacattgctggagatagt
accatgtgcagggactatgtcttagactgcaatatccttccccctcttttgcagctattt
tcaaagcaaaactgcctgaccatgacccggaatgcagtatgggctttgtctaatctctgt
agagggaaaagtccacctccagaatttgcaaaggtttccccctgtctgaatgtgctttcc
tggttgctgtttgtcagtgacactgatgtactggctgatgcctgctgggctctctcatat
ctatcagatggacccaatgataaaattcaagcagtcattgatgctggagtatgtagaaga
cttgtggagctgctgatgcataatgattataaagtggtttctcctgctttgcgagctgtg
ggaaacattgtcacaggggatgatattcagacacaggtaattttgaattgctcagctctg
cagagtttattgcatttgctgagtagcccaaaggaatctatcaaaaaggaagcatgttgg
acaatatctaatatcacagctggaaatagggcacagatccagactgtgatagatgccaaa
atttttccagccctcattagtatattacaaactgctgagtttcggacaaggaaagaagca
gcttgggccatcacaaatgcaacttctggaggatcagctgaacagatcaagtacctcgta
gaactgggttgtatcaagccactctgtgatctgctcacagttatggactctaagattgta
caggttgccctaaatggcttggaaaatatcctgaggcttggagaacaagaagccaaaaga
aacggcactggcattaatccttattgtgctttgattgaagaagcttacggtctggataaa
attgagttcttgcagagtcacgaaaaccaggagatctaccagaaggcttttgatcttatt
gagcattacttcgggaccgaggatgaggacagcagcattgccccacaggttgatcttagc
cagcagcagtacatcttccagcagtgtgaggcgcctatggaaggcttccagctttga

KEGG   Hipposideros armiger (great roundleaf bat): 109389758
Entry
109389758         CDS       T04661                                 

Gene name
KPNA7
Definition
(RefSeq) karyopherin subunit alpha 7
  KO
K15043  importin subunit alpha-1/8
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hai00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    109389758 (KPNA7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hai03036]
    109389758 (KPNA7)
Chromosome and associated proteins [BR:hai03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    109389758 (KPNA7)
SSDB
Motif
Pfam: Arm IBB Arm_3 HEAT_2 HEAT_EZ HEAT
Other DBs
NCBI-GeneID: 109389758
NCBI-ProteinID: XP_019511105
LinkDB
Position
Un
AA seq 523 aa
MPTLEASEERQRKFKYRGKDASMRRQQRIVVSLQLRKAKKDEQALKRRNITSLSPDPASE
QPTKGVSLTLQEIINGVNASDPDLCFQATQATRKMLSRERNPPVNLIVKAGLIPRLVEFL
KASLHPCLQCEAAWALTNIASGTSEQTRAVVEAGALQPLVELLSSAHMIVSEQAVWALGN
IAGDGPEFRDLVIASNTIPHLLALVSSNIPITFLRNVTWTLSNLCRNKNPYPCPKAVKQM
LPILFHLLQHQDSEVLSDTCWALSYLTEGSNERIGQVVDTGVLPRLVELMASSELNVLTP
SLATVGNIVTGTDLQTQVAIDAGILSVLPQLLRHPNSTIQKEAAWALSNVAAGPHQHIQQ
LIACNVLPPLVALLKNGDFKVQKEAVWIVANFTTGGTVDQLIQLIHSGVLEPLVNLLTIQ
DTKIIIIILDIINFLLQAAEKHLEKENLCLLIEELGGVDRIEALQLHENHQVALTALNII
ENHFCEEEENGTTLPALDQDHEFLKYLTKKYQSSTTSKPRTKP
NT seq 1572 nt   +upstreamnt  +downstreamnt
atgccaactttagaagcttcagaagagaggcagagaaaatttaagtaccgaggcaaagat
gcatctatgcggcggcaacagcggatagtggtcagcctgcagctccggaaggccaagaaa
gacgagcaagccttaaagagaagaaatatcaccagtctctcccctgacccagcttctgaa
caaccaaccaaaggggtcagcctcaccctgcaagaaataatcaatggtgtgaatgcctct
gatccagatctatgtttccaggccacccaggcaaccaggaaaatgctatcccgggaaagg
aaccctcctgtaaacctgattgttaaagcaggactcatccccaggctggtggagttcctg
aaggcatcacttcacccctgcttgcagtgtgaggccgcctgggcactgaccaacattgct
tcagggacttcagagcagactcgagctgttgtggaagccggagccctccagcccttggtt
gagcttctgtcttccgcgcatatgattgtgtctgaacaggcagtgtgggcccttggtaat
atagcaggtgatggcccagaattcagagacttggttattgcaagcaacaccatcccacat
ctgctggccctggtttcatcaaacataccgattacatttctgcggaacgtcacatggacc
ttgtccaacctgtgccgaaacaagaacccgtacccttgcccaaaagctgtgaagcagatg
ctgcctatcctcttccacctcctgcagcaccaagacagcgaggttctctctgacacctgc
tgggccctgtcctacctcaccgaaggcagcaacgagcgcatcggccaagtggttgacaca
ggcgtcctgcccaggctggttgagctcatggccagctcggaactcaacgtcttgaccccc
tctctcgccactgtggggaacatcgtcacgggaacagacctccagacacaggtggccatc
gatgcgggcatcctgagtgtgctgccccaacttctgaggcaccccaactccaccatccag
aaggaggcagcctgggccctgagcaacgtggccgcagggccccaccagcacatccagcag
ctgattgcttgcaatgtgctgcctcccttggtggctctgctaaaaaatggagattttaaa
gtccagaaagaggctgtctggatagtggctaacttcacaactgggggcaccgtggaccag
ctgatccagctcatccactctggagtcttggagccactggtgaacctgctcaccatccaa
gacaccaaaattatcatcatcatcctggacatcatcaattttctcctccaggcagcagag
aagcatttggagaaggaaaacctgtgtcttctgatagaagaacttggtggggttgataga
atcgaggctttacaacttcacgagaaccatcaggttgccctgactgctttaaacattatc
gagaaccacttttgtgaggaagaagaaaatggcacaacattaccagccctggaccaagat
catgaattcttaaagtacttaacaaaaaaataccaaagctccacaacttctaaaccaagg
accaaaccctaa

KEGG   Hipposideros armiger (great roundleaf bat): 109391789
Entry
109391789         CDS       T04661                                 

Gene name
KPNA6
Definition
(RefSeq) karyopherin subunit alpha 6
  KO
K15042  importin subunit alpha-6/7
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hai00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    109391789 (KPNA6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hai03036]
    109391789 (KPNA6)
Chromosome and associated proteins [BR:hai03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    109391789 (KPNA6)
SSDB
Motif
Pfam: Arm IBB Arm_3 HEAT_EZ HEAT_2 HEAT V-ATPase_H_C Arm_2
Other DBs
NCBI-GeneID: 109391789
NCBI-ProteinID: XP_019515208
LinkDB
Position
Un
AA seq 544 aa
MDKETEAWRETMASPGKDNYRMKSYKNNALNPEEMRRRREEEGIQLRKQKREQQLFKRRN
VEMINEEAAMFDSLLMDSYVSSTTGESVITREMVEMLFSDDSDLQLATTQKFRKLLSKEP
SPPIDEVINTPGVVDRFVEFLKRNENCTLQFEAAWALTNIASGTSQQTKIVIEAGAVPIF
IELLNSDFEDVQEQAVWALGNIAGDSSVCRDYVLNCSILNPLLTLLTKSTRLTMTRNAVW
ALSNLCRGKNPPPEFAKVSPCLPVLSRLLFSSDSDLLADACWALSYLSDGPNEKIQAVID
SGVCRRLVELLMHNDYKVASPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESI
RKEACWTISNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPE
QIRYLVSLGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEGKRSGSGVNPYCGLIEE
AYGLDKIEFLQSHENQEIYQKAFDLIEHYFGVEDDDSSLAPQVDETQQQFIFQQPEAPME
GFQL
NT seq 1635 nt   +upstreamnt  +downstreamnt
atggataaggaaactgaggcttggagagagaccatggcgagcccagggaaagacaattat
cgaatgaagagctataagaacaatgccctaaaccctgaggaaatgaggcgaagaagagaa
gaagagggcattcagctccggaagcagaagcgggaacaacaactttttaaacggagaaat
gtggagatgattaatgaagaagctgccatgttcgatagtctcctcatggactcctatgtg
agctctaccactggggagagtgtgatcacaagagagatggtagagatgctcttttctgat
gattctgacctgcagttagcaaccacacagaaattccggaaactgctctccaaagagcct
agtcctccaatagatgaagttatcaacactccaggagtggtggatcggtttgtggagttc
ctgaagaggaatgagaattgtacattacagtttgaagctgcctgggctctaacgaatatt
gcctctggaacctcgcagcagaccaaaattgtcattgaagcaggggctgtccccattttt
atagagctgcttaactcggactttgaggatgtacaggaacaggcagtctgggcactggga
aacatagctggagacagctccgtttgccgagattacgtcttgaactgttccatccttaat
cctttgttaacactccttacaaaatccacacgactgacaatgacacggaatgcagtctgg
gcactgtcaaacctctgccgagggaagaacccacccccagagtttgcaaaggtctcccct
tgtttgcctgtgctgtctcgcctactcttcagcagcgactcagacttgctggcagatgct
tgctgggccctttcttatctgtccgatggccccaacgagaagatccaggcggtcatagac
tctggagtctgcaggagattggtagaactcctaatgcataatgattacaaagtggcttcg
cctgccctgagagctgtggggaacatcgtcactggggatgacatccagacccaggttatt
cttaactgttcagccctcccttgtctcctccacttgctgagcagccccaaggagtcaatc
cggaaggaagcttgctggaccatttcaaatatcactgctggcaacagggctcaaatacag
gctgtcatagatgcaaatatcttccctgtgttgatcgaaatccttcagaaagcagagttc
cgtacaaggaaagaggcagcctgggccatcaccaatgccacatcaggaggcacccctgag
cagatcaggtacctggtctcactgggctgcatcaaacccctgtgcgacttgctgactgtg
atggattcaaagattgtgcaagtggccctcaatggactggagaacatccttcggcttgga
gagcaagagggcaagcgcagtggctcgggggtcaatccctactgtggcctcattgaggaa
gcctatggcttggataaaattgagtttctccagagccatgagaaccaggagatctaccag
aaggccttcgacctcattgagcactactttggtgtagaagatgatgatagcagcctggcc
ccccaagtggatgaaacacaacagcagttcatcttccagcagcctgaggcccccatggag
ggcttccagctataa

KEGG   Hipposideros armiger (great roundleaf bat): 109396460
Entry
109396460         CDS       T04661                                 

Gene name
KPNA5
Definition
(RefSeq) karyopherin subunit alpha 5
  KO
K15042  importin subunit alpha-6/7
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hai00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    109396460 (KPNA5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hai03036]
    109396460 (KPNA5)
Chromosome and associated proteins [BR:hai03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    109396460 (KPNA5)
SSDB
Motif
Pfam: Arm IBB Arm_3 HEAT_EZ HEAT_2 HEAT V-ATPase_H_C RICTOR_V Arm_2 V-ATPase_H_N DUF3818 CLASP_N
Other DBs
NCBI-GeneID: 109396460
NCBI-ProteinID: XP_019523829
LinkDB
Position
Un
AA seq 558 aa
MDAMASPGKDNYRMKSYKNKALNPQEMRRRREEEGIQLRKQKREEQLFKRRNVSLPRNDE
SMLESPIQDPDISSTVPIPEEEVITTDMVQMIFSNNADQQLTATQKFRKLLSKEPNPPID
QVIQKPGVVQRFVKFLERNENCTLQFEAAWALTNIASGTFLHTKVVIETGAVPIFIKLLN
SEHEDVQEQAVWALGNIAGDNAECRDFVLNCEILPPLLELLTNSNRLTTTRNAVWALSNL
CRGKNPPPNFSKPMTLLPTSVRKWKHSEENFHRLPSPHLASCRHCSDPDVLADVCWALSY
LSDGPNDKIQAVIDSGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSAL
PCLLHLLSSPKESIRKEACWTVSNITAGNRAQIQSVIDANIFPVLIEILQKAEFRTRKEA
AWAVTNATSGGTPEQIRYLVALGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQ
NGIGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGVEDDDPSIVPQVDEN
QQQFVFQQQEAPMEGFQL
NT seq 1677 nt   +upstreamnt  +downstreamnt
atggatgccatggctagtccagggaaagataactatagaatgaaaagttataagaataaa
gccctgaatccccaagagatgcgtagacgaagagaagaagaaggaatacaacttcgaaaa
caaaaaagagaagaacagctgttcaaacgtagaaatgtctctttgcccagaaatgatgaa
tccatgctagaaagtcctatccaggatccggatatcagttccactgtacccatcccagag
gaagaagttattaccacggatatggttcagatgattttttctaataatgctgatcagcaa
ctaacagcaacacagaaatttagaaagctactttcgaaagaacctaacccaccaattgat
caagttatacagaaaccaggagttgtacagagatttgtgaaatttcttgaaagaaatgaa
aattgtactttacaatttgaagctgcatgggcattgactaatatagcatctggaactttt
ctgcataccaaggttgtgattgaaactggggctgttccaatttttatcaaacttcttaat
tcagaacatgaagatgttcaagaacaggctgtttgggcacttggcaatattgctggtgac
aatgcagaatgcagagattttgttttgaattgtgaaatccttcctcctcttttagagtta
ttaacaaattcaaacaggcttacaacaaccagaaatgctgtatgggccctctcaaattta
tgtagaggcaaaaaccctcctccaaactttagtaagcctatgaccttgcttcctacttca
gtgagaaaatggaagcactcagaagagaacttccatagattaccatcaccacatttggca
tcctgtcgtcattgcagtgacccagatgtattagcagatgtgtgttgggccctttcttat
ctctccgatggacccaatgataaaattcaagcagtcattgattctggagtgtgtcgaaga
ttggtggaacttttgatgcacaatgattataaagttgtatcacctgcattaagagcagtt
ggtaatattgtgactggtgatgatattcaaacacaggtcattttgaattgctctgcatta
ccctgtctcttacacttattgagtagcccaaaggagtcaatcagaaaagaagcctgttgg
actgtttctaacattactgctggaaatagagctcagattcagtctgttatagatgcaaat
atttttcctgttttgattgaaattcttcagaaagcagagtttcgtaccagaaaagaagca
gcttgggctgtaactaatgcaacatcaggaggcactccagaacaaataaggtatttggta
gccttaggctgcattaaaccactttgtgacctattgactgttatggactctaaaatagtc
caagtggctttaaatggacttgaaaatattttacgtcttggagaacaagaatctaagcag
aatgggataggcattaatccatactgtgctctcattgaggaagcatatggtctggataag
attgaatttctgcaaagccatgaaaatcaagaaatttaccaaaaggcttttgatctgatt
gaacattactttggtgtggaagatgacgaccccagtattgtacctcaggtggatgaaaac
caacaacagtttgtgtttcaacagcaggaagcaccaatggaagggtttcaactttaa

DBGET integrated database retrieval system