KEGG   Hipposideros armiger (great roundleaf bat): 109390108
Entry
109390108         CDS       T04661                                 

Gene name
TRADD
Definition
(RefSeq) TNFRSF1A associated via death domain
  KO
K03171  tumor necrosis factor receptor type 1-associated DEATH domain protein
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04010  MAPK signaling pathway
hai04064  NF-kappa B signaling pathway
hai04071  Sphingolipid signaling pathway
hai04210  Apoptosis
hai04217  Necroptosis
hai04622  RIG-I-like receptor signaling pathway
hai04657  IL-17 signaling pathway
hai04668  TNF signaling pathway
hai04920  Adipocytokine signaling pathway
hai05132  Salmonella infection
hai05152  Tuberculosis
hai05160  Hepatitis C
hai05162  Measles
hai05163  Human cytomegalovirus infection
hai05164  Influenza A
hai05165  Human papillomavirus infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05170  Human immunodeficiency virus 1 infection
hai05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109390108 (TRADD)
   04064 NF-kappa B signaling pathway
    109390108 (TRADD)
   04668 TNF signaling pathway
    109390108 (TRADD)
   04071 Sphingolipid signaling pathway
    109390108 (TRADD)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109390108 (TRADD)
   04217 Necroptosis
    109390108 (TRADD)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    109390108 (TRADD)
   04657 IL-17 signaling pathway
    109390108 (TRADD)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    109390108 (TRADD)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109390108 (TRADD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109390108 (TRADD)
   05152 Tuberculosis
    109390108 (TRADD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109390108 (TRADD)
   05162 Measles
    109390108 (TRADD)
   05164 Influenza A
    109390108 (TRADD)
   05160 Hepatitis C
    109390108 (TRADD)
   05168 Herpes simplex virus 1 infection
    109390108 (TRADD)
   05163 Human cytomegalovirus infection
    109390108 (TRADD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109390108 (TRADD)
   05169 Epstein-Barr virus infection
    109390108 (TRADD)
   05165 Human papillomavirus infection
    109390108 (TRADD)
SSDB
Motif
Pfam: TRADD_N Death CARD_2
Other DBs
NCBI-GeneID: 109390108
NCBI-ProteinID: XP_019511720
LinkDB
Position
Un
AA seq 342 aa
MCTPPAGFLFSHIFQANGPCWNLHVYPGASGGKMAAGPKGLEEWVGSAYLFVESSLDKVV
LSDAYAHPQQKVEVYRALRTALAESGSPDVLQMLKIHRSDPQLIVQLRFSGRQPCSRFLC
AYREGALRTVLESRLAAALALRSMPLQLELRAGTELLDALLTEEERCLSFIFAQKPDRLR
DEELVELEDALRNLTCGSGGQGGDVEVAPAPAQSLVPSTSEEKRPPPSGQTFLFQGHPVV
NRPLSLQDQQTFARSVGLKWRKVGRSLQRGCRALRDPALDSLAYEYEREGLYEQAFQLLR
RFVQAEGRRATLQRLVEALEENELTSLAEDLLGLENPDGSLP
NT seq 1029 nt   +upstreamnt  +downstreamnt
atgtgtacaccacctgccggttttctattttcccatattttccaagccaacggcccttgc
tggaatttgcacgtgtatcctggagcttcaggaggcaagatggcggctgggccaaagggg
cttgaggagtgggtgggcagcgcgtacctgtttgtggagtcctcgctggacaaggtggtc
ctgtcggatgcctacgctcacccccagcagaaggtggaggtgtacagggctctgcggact
gcattggcagaaagcgggagcccagacgtgctgcagatgctcaagattcaccgcagcgac
ccgcagctgatcgtgcagttgcgtttctccgggcgccagccctgcagccgcttcctctgc
gcctaccgcgagggggcgctgcgcaccgtgctggagagccgcttggctgcggcgctcgcc
ctgcgctccatgccgttgcaactggagctgcgcgccggcacggagctgctggatgccttg
ctcacggaagaggagcgctgtttgagtttcatcttcgcccagaagcccgaccggctccgg
gacgaggaactcgttgagttggaggatgcgctccggaatctgacgtgcggctccgggggc
cagggtggcgatgtggaggtcgctccagcccccgcgcagtccctggtgccctctacgtcg
gaggagaagcggccgccgccatctggccagacatttctgttccagggtcatcccgtagtg
aatcggccgctaagcctgcaggaccaacagacgttcgcgcgctccgtgggcctcaaatgg
cgcaaggtggggcgctctctgcagcgtggctgtcgagcgctgcgggacccggctctcgac
tccctggcctatgaatacgaacgagaggggctgtacgagcaggccttccagctactgcgg
cgctttgtgcaggccgagggccgccgcgccacgctgcagcgcctggtggaggcgttggaa
gagaatgagctcaccagcctggcagaggacttgctgggcctggagaatcctgatggcagc
ctgccctag

DBGET integrated database retrieval system