KEGG   Hipposideros armiger (great roundleaf bat): 109393491
Entry
109393491         CDS       T04661                                 

Gene name
MYD88
Definition
(RefSeq) myeloid differentiation primary response 88
  KO
K04729  myeloid differentiation primary response protein MyD88
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04010  MAPK signaling pathway
hai04064  NF-kappa B signaling pathway
hai04620  Toll-like receptor signaling pathway
hai04621  NOD-like receptor signaling pathway
hai05132  Salmonella infection
hai05133  Pertussis
hai05134  Legionellosis
hai05135  Yersinia infection
hai05140  Leishmaniasis
hai05142  Chagas disease
hai05143  African trypanosomiasis
hai05144  Malaria
hai05145  Toxoplasmosis
hai05152  Tuberculosis
hai05161  Hepatitis B
hai05162  Measles
hai05164  Influenza A
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05170  Human immunodeficiency virus 1 infection
hai05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109393491 (MYD88)
   04064 NF-kappa B signaling pathway
    109393491 (MYD88)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109393491 (MYD88)
   04621 NOD-like receptor signaling pathway
    109393491 (MYD88)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109393491 (MYD88)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109393491 (MYD88)
   05135 Yersinia infection
    109393491 (MYD88)
   05133 Pertussis
    109393491 (MYD88)
   05134 Legionellosis
    109393491 (MYD88)
   05152 Tuberculosis
    109393491 (MYD88)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109393491 (MYD88)
   05162 Measles
    109393491 (MYD88)
   05164 Influenza A
    109393491 (MYD88)
   05161 Hepatitis B
    109393491 (MYD88)
   05168 Herpes simplex virus 1 infection
    109393491 (MYD88)
   05169 Epstein-Barr virus infection
    109393491 (MYD88)
  09174 Infectious disease: parasitic
   05144 Malaria
    109393491 (MYD88)
   05145 Toxoplasmosis
    109393491 (MYD88)
   05140 Leishmaniasis
    109393491 (MYD88)
   05142 Chagas disease
    109393491 (MYD88)
   05143 African trypanosomiasis
    109393491 (MYD88)
SSDB
Motif
Pfam: Death TIR_2 TIR
Other DBs
NCBI-GeneID: 109393491
NCBI-ProteinID: XP_019518313
LinkDB
Position
Un
AA seq 296 aa
MAAGVPGAGSATPALSMSSLPLAALNVRVRRRLSLFLNVRTQVAADWATLAEEMQFEYLE
IRQLEKHSDPTGRLLDDWQGRPGASVGRLLELLAKLGRDDVLLELGPSIEEDCQKYILKQ
QQEESEKPLQVAAVDSSVPRTTELAGITTLDDPLGQMPERFDAFICYCSSDIQFVQEMIQ
QLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVIVSDDYLQSKECDFQTKFA
LSLSPGAHQKRLIPVKYKEMKKEFPSILRFITVCDYTNPCTKNWFWTRLAKALSLP
NT seq 891 nt   +upstreamnt  +downstreamnt
atggctgcaggagtccccggcgcgggctccgcgacccccgccctctccatgtcctccctg
cccctggctgcgctcaacgtgcgagtacgacgacgcctgtcgctgttcctgaacgtgcgg
acgcaggttgcggccgactgggccacactggcagaggagatgcagttcgagtacttggag
atccggcagctggagaagcactccgaccccacgggcagactgctggacgactggcaggga
cgccccggcgcctcggtgggccgtctgttggagctgctagctaagctgggtcgcgatgat
gtgctgctggaactggggcctagtatcgaggaggattgccaaaagtatattctgaagcag
cagcaggaggagtctgagaagcccttacaggtggctgctgtagacagcagcgtcccacgg
acaacagagctggcgggcattaccacacttgatgaccccctggggcaaatgcctgagcga
tttgatgcttttatctgctactgctccagcgacatccagtttgtgcaggagatgatccag
cagctggaacagacaaactatcggctgaagttgtgtgtgtccgaccgcgatgtcctgcct
ggcacctgtgtctggtctatcgccagtgagctcattgagaagaggtgccgccggatggtg
gtgattgtctcagatgactacctgcaaagcaaggagtgtgacttccagactaagtttgcg
ctcagcctgtctccaggtgcccatcagaagcgactgattcctgtcaagtacaaggaaatg
aagaaagagttccccagcatcctgcggttcatcactgtctgcgactacaccaacccctgc
accaaaaactggttctggactcgccttgccaaagccttgtccctgccctga

DBGET integrated database retrieval system