Hipposideros armiger (great roundleaf bat): 109393524 Help Entry 109393524         CDS       T04661                                  Gene name IL1B Definition (RefSeq) interleukin 1 beta   KO K04519   interleukin 1 beta Organism hai  Hipposideros armiger (great roundleaf bat) Pathway hai01523   Antifolate resistance hai04010   MAPK signaling pathway hai04060   Cytokine-cytokine receptor interaction hai04064   NF-kappa B signaling pathway hai04217   Necroptosis hai04380   Osteoclast differentiation hai04620   Toll-like receptor signaling pathway hai04621   NOD-like receptor signaling pathway hai04623   Cytosolic DNA-sensing pathway hai04625   C-type lectin receptor signaling pathway hai04640   Hematopoietic cell lineage hai04657   IL-17 signaling pathway hai04659   Th17 cell differentiation hai04668   TNF signaling pathway hai04750   Inflammatory mediator regulation of TRP channels hai04932   Non-alcoholic fatty liver disease hai04933   AGE-RAGE signaling pathway in diabetic complications hai04940   Type I diabetes mellitus hai05010   Alzheimer disease hai05020   Prion disease hai05022   Pathways of neurodegeneration - multiple diseases hai05132   Salmonella infection hai05133   Pertussis hai05134   Legionellosis hai05135   Yersinia infection hai05140   Leishmaniasis hai05142   Chagas disease hai05143   African trypanosomiasis hai05144   Malaria hai05146   Amoebiasis hai05152   Tuberculosis hai05162   Measles hai05163   Human cytomegalovirus infection hai05164   Influenza A hai05168   Herpes simplex virus 1 infection hai05321   Inflammatory bowel disease hai05323   Rheumatoid arthritis hai05332   Graft-versus-host disease hai05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:hai00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109393524 (IL1B)    04064 NF-kappa B signaling pathway     109393524 (IL1B)    04668 TNF signaling pathway     109393524 (IL1B)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109393524 (IL1B)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     109393524 (IL1B)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     109393524 (IL1B)    04620 Toll-like receptor signaling pathway     109393524 (IL1B)    04621 NOD-like receptor signaling pathway     109393524 (IL1B)    04623 Cytosolic DNA-sensing pathway     109393524 (IL1B)    04625 C-type lectin receptor signaling pathway     109393524 (IL1B)    04659 Th17 cell differentiation     109393524 (IL1B)    04657 IL-17 signaling pathway     109393524 (IL1B)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     109393524 (IL1B)   09158 Development and regeneration    04380 Osteoclast differentiation     109393524 (IL1B)  09160 Human Diseases   09163 Immune disease    05323 Rheumatoid arthritis     109393524 (IL1B)    05321 Inflammatory bowel disease     109393524 (IL1B)    05332 Graft-versus-host disease     109393524 (IL1B)   09164 Neurodegenerative disease    05010 Alzheimer disease     109393524 (IL1B)    05020 Prion disease     109393524 (IL1B)    05022 Pathways of neurodegeneration - multiple diseases     109393524 (IL1B)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     109393524 (IL1B)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     109393524 (IL1B)    04932 Non-alcoholic fatty liver disease     109393524 (IL1B)    04933 AGE-RAGE signaling pathway in diabetic complications     109393524 (IL1B)   09171 Infectious disease: bacterial    05132 Salmonella infection     109393524 (IL1B)    05135 Yersinia infection     109393524 (IL1B)    05133 Pertussis     109393524 (IL1B)    05134 Legionellosis     109393524 (IL1B)    05152 Tuberculosis     109393524 (IL1B)   09172 Infectious disease: viral    05162 Measles     109393524 (IL1B)    05164 Influenza A     109393524 (IL1B)    05168 Herpes simplex virus 1 infection     109393524 (IL1B)    05163 Human cytomegalovirus infection     109393524 (IL1B)   09174 Infectious disease: parasitic    05146 Amoebiasis     109393524 (IL1B)    05144 Malaria     109393524 (IL1B)    05140 Leishmaniasis     109393524 (IL1B)    05142 Chagas disease     109393524 (IL1B)    05143 African trypanosomiasis     109393524 (IL1B)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     109393524 (IL1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:hai04052]     109393524 (IL1B)    00536 Glycosaminoglycan binding proteins [BR:hai00536]     109393524 (IL1B) Cytokines and growth factors [BR:hai04052]  Cytokines   Interleukins    109393524 (IL1B) Glycosaminoglycan binding proteins [BR:hai00536]  Heparan sulfate / Haparin   Cytokines    109393524 (IL1B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL1 IL1_propep SUN Motif Other DBs NCBI-GeneID:  109393524 NCBI-ProteinID:  XP_019518405 LinkDB All DBs Position Un AA seq 266 aa AA seqDB search MAAVPELASEMMAYYSGNENDLFFEADGPRQTKCSFQDLDLSSLGDGAIQLQVSQQLHNA SFRKIVSVVVAMEKLRKVPIVFSQDFQDDDLRSLFFLIFEEETISCLWDDTYVCDAPLQS LNCRLQDVNHKALVLSGPHELQAVHLNGQDVSQQVVFCMSFMPGEENNKTPVALGIKEKN LYLSCVMKDDKPTLQLETVDSKGLSKKMEKRFVFNKTEINSKVEFESALYPNWYISTLQE EQRPVFLGNQKGGKDITDFTLDILSR NT seq 801 nt NT seq  +upstreamnt  +downstreamnt atggcagcagtacctgaactcgccagtgagatgatggcttactacagtggcaacgagaat gacctgttctttgaggctgatggccccagacagaccaagtgctccttccaagacctggac ctcagctctctgggcgatggggccatccagctgcaagtctcccagcagctccacaacgca agtttcaggaagattgtatcggtcgtagtggccatggagaagctgaggaaggtgcccatt gtcttctcccaggacttccaggatgacgacttgaggagcctctttttcctcatctttgaa gaagaaaccatcagctgcttgtgggatgacacttacgtgtgtgatgcgcccctgcagtcg ctgaactgcagactccaggacgtaaaccataaagcgctggtgctttccgggccacatgag ctacaggctgttcacctcaatggacaggatgtgagccagcaagtggtgttctgcatgagc tttatgccaggagaagaaaataacaagacacctgtggccttgggcatcaaggaaaagaac ctgtacctgtcttgtgtgatgaaggatgacaaacccaccctacagctggagacagtagac tccaaaggtctgtctaagaagatggaaaaacggtttgtcttcaacaagacggaaatcaac agtaaggtggaatttgagtcagccctataccccaactggtacatcagcaccttgcaagag gaacagaggcccgtcttcctaggaaatcaaaaaggtggaaaggacataactgacttcacc ctggacatcctctctcgctag

Hipposideros armiger (great roundleaf bat): 109393526 Help Entry 109393526         CDS       T04661                                  Gene name IL1A Definition (RefSeq) interleukin 1 alpha   KO K04383   interleukin 1 alpha Organism hai  Hipposideros armiger (great roundleaf bat) Pathway hai04010   MAPK signaling pathway hai04060   Cytokine-cytokine receptor interaction hai04217   Necroptosis hai04218   Cellular senescence hai04380   Osteoclast differentiation hai04640   Hematopoietic cell lineage hai04932   Non-alcoholic fatty liver disease hai04933   AGE-RAGE signaling pathway in diabetic complications hai04940   Type I diabetes mellitus hai05010   Alzheimer disease hai05020   Prion disease hai05022   Pathways of neurodegeneration - multiple diseases hai05133   Pertussis hai05140   Leishmaniasis hai05152   Tuberculosis hai05162   Measles hai05164   Influenza A hai05321   Inflammatory bowel disease hai05323   Rheumatoid arthritis hai05332   Graft-versus-host disease hai05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:hai00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109393526 (IL1A)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109393526 (IL1A)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     109393526 (IL1A)    04218 Cellular senescence     109393526 (IL1A)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     109393526 (IL1A)   09158 Development and regeneration    04380 Osteoclast differentiation     109393526 (IL1A)  09160 Human Diseases   09163 Immune disease    05323 Rheumatoid arthritis     109393526 (IL1A)    05321 Inflammatory bowel disease     109393526 (IL1A)    05332 Graft-versus-host disease     109393526 (IL1A)   09164 Neurodegenerative disease    05010 Alzheimer disease     109393526 (IL1A)    05020 Prion disease     109393526 (IL1A)    05022 Pathways of neurodegeneration - multiple diseases     109393526 (IL1A)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     109393526 (IL1A)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     109393526 (IL1A)    04932 Non-alcoholic fatty liver disease     109393526 (IL1A)    04933 AGE-RAGE signaling pathway in diabetic complications     109393526 (IL1A)   09171 Infectious disease: bacterial    05133 Pertussis     109393526 (IL1A)    05152 Tuberculosis     109393526 (IL1A)   09172 Infectious disease: viral    05162 Measles     109393526 (IL1A)    05164 Influenza A     109393526 (IL1A)   09174 Infectious disease: parasitic    05140 Leishmaniasis     109393526 (IL1A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:hai04052]     109393526 (IL1A) Cytokines and growth factors [BR:hai04052]  Cytokines   Interleukins    109393526 (IL1A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL1_propep IL1 Motif Other DBs NCBI-GeneID:  109393526 NCBI-ProteinID:  XP_019518409 LinkDB All DBs Position Un AA seq 270 aa AA seqDB search MAKVPDLFEDLKNCYSANEDYGSEIDQLSLNQKSFYDASYDPLHEDCMDKFTSLSTKEAS KTSQLTFKESVVMVAGNGKVLKKRRLSFNQVITDDDLEAVANDPEEEIIQPRVAAPSSQS NIKYIFKNVIKQRCILNDTLHQTIIRDTSGPYLMAAALHDLDQAVKFDMGMYTSNDDSKL PVTLRISKTRLFLSAQEEDEPVLLKEMPETPKVIKDETNLLFFLEGHGTKNYFESVTHPT LFIATKQEHPVHMARGQPSITDFEILENQP NT seq 813 nt NT seq  +upstreamnt  +downstreamnt atggccaaagtccctgacctctttgaagacctgaagaactgttacagtgcaaatgaagac tacggttccgaaattgaccaactctctctgaatcagaaatccttctatgatgcaagctat gacccacttcacgaggactgcatggataaatttacatctctgagtaccaaggaggcctct aagacttcccagcttaccttcaaagagagtgtggtgatggtggcaggcaatgggaaggtt ctgaagaagagacggctgagtttcaaccaggtcatcaccgatgacgatctggaagctgtt gccaatgacccagaagaagaaatcatccagcccagagtggcagctcccagctcccagagt aacattaagtacatcttcaaaaacgtcatcaaacaacgctgcatcctgaatgacaccctc catcaaactatcattcgagacacatcgggtccatatctcatggcagccgcattgcatgac ctggaccaagcagtgaaatttgacatgggtatgtatacatcaaatgacgactctaaattg cctgtgactctaagaatctcaaaaacgcgactatttttgagtgcccaagaggaagacgaa cctgtattgctaaaggagatgcctgagacacccaaagtcatcaaagatgagaccaacctc cttttcttcttggaaggtcatggcactaagaactacttcgagtcagtgacccacccaacg ttatttattgctacaaagcaagaacacccagtgcacatggcaagggggcaaccgtctatc actgattttgagatactcgaaaaccaaccttga

DBGET integrated database retrieval system