KEGG   Hipposideros armiger (great roundleaf bat): 109393524
Entry
109393524         CDS       T04661                                 

Gene name
IL1B
Definition
(RefSeq) interleukin 1 beta
  KO
K04519  interleukin 1 beta
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01523  Antifolate resistance
hai04010  MAPK signaling pathway
hai04060  Cytokine-cytokine receptor interaction
hai04064  NF-kappa B signaling pathway
hai04217  Necroptosis
hai04380  Osteoclast differentiation
hai04620  Toll-like receptor signaling pathway
hai04621  NOD-like receptor signaling pathway
hai04623  Cytosolic DNA-sensing pathway
hai04625  C-type lectin receptor signaling pathway
hai04640  Hematopoietic cell lineage
hai04657  IL-17 signaling pathway
hai04659  Th17 cell differentiation
hai04668  TNF signaling pathway
hai04750  Inflammatory mediator regulation of TRP channels
hai04932  Non-alcoholic fatty liver disease
hai04933  AGE-RAGE signaling pathway in diabetic complications
hai04940  Type I diabetes mellitus
hai05010  Alzheimer disease
hai05020  Prion disease
hai05022  Pathways of neurodegeneration - multiple diseases
hai05132  Salmonella infection
hai05133  Pertussis
hai05134  Legionellosis
hai05135  Yersinia infection
hai05140  Leishmaniasis
hai05142  Chagas disease
hai05143  African trypanosomiasis
hai05144  Malaria
hai05146  Amoebiasis
hai05152  Tuberculosis
hai05162  Measles
hai05163  Human cytomegalovirus infection
hai05164  Influenza A
hai05168  Herpes simplex virus 1 infection
hai05321  Inflammatory bowel disease
hai05323  Rheumatoid arthritis
hai05332  Graft-versus-host disease
hai05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109393524 (IL1B)
   04064 NF-kappa B signaling pathway
    109393524 (IL1B)
   04668 TNF signaling pathway
    109393524 (IL1B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109393524 (IL1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109393524 (IL1B)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109393524 (IL1B)
   04620 Toll-like receptor signaling pathway
    109393524 (IL1B)
   04621 NOD-like receptor signaling pathway
    109393524 (IL1B)
   04623 Cytosolic DNA-sensing pathway
    109393524 (IL1B)
   04625 C-type lectin receptor signaling pathway
    109393524 (IL1B)
   04659 Th17 cell differentiation
    109393524 (IL1B)
   04657 IL-17 signaling pathway
    109393524 (IL1B)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109393524 (IL1B)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109393524 (IL1B)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    109393524 (IL1B)
   05321 Inflammatory bowel disease
    109393524 (IL1B)
   05332 Graft-versus-host disease
    109393524 (IL1B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109393524 (IL1B)
   05020 Prion disease
    109393524 (IL1B)
   05022 Pathways of neurodegeneration - multiple diseases
    109393524 (IL1B)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109393524 (IL1B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109393524 (IL1B)
   04932 Non-alcoholic fatty liver disease
    109393524 (IL1B)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109393524 (IL1B)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109393524 (IL1B)
   05135 Yersinia infection
    109393524 (IL1B)
   05133 Pertussis
    109393524 (IL1B)
   05134 Legionellosis
    109393524 (IL1B)
   05152 Tuberculosis
    109393524 (IL1B)
  09172 Infectious disease: viral
   05162 Measles
    109393524 (IL1B)
   05164 Influenza A
    109393524 (IL1B)
   05168 Herpes simplex virus 1 infection
    109393524 (IL1B)
   05163 Human cytomegalovirus infection
    109393524 (IL1B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109393524 (IL1B)
   05144 Malaria
    109393524 (IL1B)
   05140 Leishmaniasis
    109393524 (IL1B)
   05142 Chagas disease
    109393524 (IL1B)
   05143 African trypanosomiasis
    109393524 (IL1B)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    109393524 (IL1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hai04052]
    109393524 (IL1B)
   00536 Glycosaminoglycan binding proteins [BR:hai00536]
    109393524 (IL1B)
Cytokines and growth factors [BR:hai04052]
 Cytokines
  Interleukins
   109393524 (IL1B)
Glycosaminoglycan binding proteins [BR:hai00536]
 Heparan sulfate / Haparin
  Cytokines
   109393524 (IL1B)
SSDB
Motif
Pfam: IL1 IL1_propep SUN
Other DBs
NCBI-GeneID: 109393524
NCBI-ProteinID: XP_019518405
LinkDB
Position
Un
AA seq 266 aa
MAAVPELASEMMAYYSGNENDLFFEADGPRQTKCSFQDLDLSSLGDGAIQLQVSQQLHNA
SFRKIVSVVVAMEKLRKVPIVFSQDFQDDDLRSLFFLIFEEETISCLWDDTYVCDAPLQS
LNCRLQDVNHKALVLSGPHELQAVHLNGQDVSQQVVFCMSFMPGEENNKTPVALGIKEKN
LYLSCVMKDDKPTLQLETVDSKGLSKKMEKRFVFNKTEINSKVEFESALYPNWYISTLQE
EQRPVFLGNQKGGKDITDFTLDILSR
NT seq 801 nt   +upstreamnt  +downstreamnt
atggcagcagtacctgaactcgccagtgagatgatggcttactacagtggcaacgagaat
gacctgttctttgaggctgatggccccagacagaccaagtgctccttccaagacctggac
ctcagctctctgggcgatggggccatccagctgcaagtctcccagcagctccacaacgca
agtttcaggaagattgtatcggtcgtagtggccatggagaagctgaggaaggtgcccatt
gtcttctcccaggacttccaggatgacgacttgaggagcctctttttcctcatctttgaa
gaagaaaccatcagctgcttgtgggatgacacttacgtgtgtgatgcgcccctgcagtcg
ctgaactgcagactccaggacgtaaaccataaagcgctggtgctttccgggccacatgag
ctacaggctgttcacctcaatggacaggatgtgagccagcaagtggtgttctgcatgagc
tttatgccaggagaagaaaataacaagacacctgtggccttgggcatcaaggaaaagaac
ctgtacctgtcttgtgtgatgaaggatgacaaacccaccctacagctggagacagtagac
tccaaaggtctgtctaagaagatggaaaaacggtttgtcttcaacaagacggaaatcaac
agtaaggtggaatttgagtcagccctataccccaactggtacatcagcaccttgcaagag
gaacagaggcccgtcttcctaggaaatcaaaaaggtggaaaggacataactgacttcacc
ctggacatcctctctcgctag

KEGG   Hipposideros armiger (great roundleaf bat): 109393526
Entry
109393526         CDS       T04661                                 

Gene name
IL1A
Definition
(RefSeq) interleukin 1 alpha
  KO
K04383  interleukin 1 alpha
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04010  MAPK signaling pathway
hai04060  Cytokine-cytokine receptor interaction
hai04217  Necroptosis
hai04218  Cellular senescence
hai04380  Osteoclast differentiation
hai04640  Hematopoietic cell lineage
hai04932  Non-alcoholic fatty liver disease
hai04933  AGE-RAGE signaling pathway in diabetic complications
hai04940  Type I diabetes mellitus
hai05010  Alzheimer disease
hai05020  Prion disease
hai05022  Pathways of neurodegeneration - multiple diseases
hai05133  Pertussis
hai05140  Leishmaniasis
hai05152  Tuberculosis
hai05162  Measles
hai05164  Influenza A
hai05321  Inflammatory bowel disease
hai05323  Rheumatoid arthritis
hai05332  Graft-versus-host disease
hai05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109393526 (IL1A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109393526 (IL1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109393526 (IL1A)
   04218 Cellular senescence
    109393526 (IL1A)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109393526 (IL1A)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109393526 (IL1A)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    109393526 (IL1A)
   05321 Inflammatory bowel disease
    109393526 (IL1A)
   05332 Graft-versus-host disease
    109393526 (IL1A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109393526 (IL1A)
   05020 Prion disease
    109393526 (IL1A)
   05022 Pathways of neurodegeneration - multiple diseases
    109393526 (IL1A)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109393526 (IL1A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109393526 (IL1A)
   04932 Non-alcoholic fatty liver disease
    109393526 (IL1A)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109393526 (IL1A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    109393526 (IL1A)
   05152 Tuberculosis
    109393526 (IL1A)
  09172 Infectious disease: viral
   05162 Measles
    109393526 (IL1A)
   05164 Influenza A
    109393526 (IL1A)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    109393526 (IL1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hai04052]
    109393526 (IL1A)
Cytokines and growth factors [BR:hai04052]
 Cytokines
  Interleukins
   109393526 (IL1A)
SSDB
Motif
Pfam: IL1_propep IL1
Other DBs
NCBI-GeneID: 109393526
NCBI-ProteinID: XP_019518409
LinkDB
Position
Un
AA seq 270 aa
MAKVPDLFEDLKNCYSANEDYGSEIDQLSLNQKSFYDASYDPLHEDCMDKFTSLSTKEAS
KTSQLTFKESVVMVAGNGKVLKKRRLSFNQVITDDDLEAVANDPEEEIIQPRVAAPSSQS
NIKYIFKNVIKQRCILNDTLHQTIIRDTSGPYLMAAALHDLDQAVKFDMGMYTSNDDSKL
PVTLRISKTRLFLSAQEEDEPVLLKEMPETPKVIKDETNLLFFLEGHGTKNYFESVTHPT
LFIATKQEHPVHMARGQPSITDFEILENQP
NT seq 813 nt   +upstreamnt  +downstreamnt
atggccaaagtccctgacctctttgaagacctgaagaactgttacagtgcaaatgaagac
tacggttccgaaattgaccaactctctctgaatcagaaatccttctatgatgcaagctat
gacccacttcacgaggactgcatggataaatttacatctctgagtaccaaggaggcctct
aagacttcccagcttaccttcaaagagagtgtggtgatggtggcaggcaatgggaaggtt
ctgaagaagagacggctgagtttcaaccaggtcatcaccgatgacgatctggaagctgtt
gccaatgacccagaagaagaaatcatccagcccagagtggcagctcccagctcccagagt
aacattaagtacatcttcaaaaacgtcatcaaacaacgctgcatcctgaatgacaccctc
catcaaactatcattcgagacacatcgggtccatatctcatggcagccgcattgcatgac
ctggaccaagcagtgaaatttgacatgggtatgtatacatcaaatgacgactctaaattg
cctgtgactctaagaatctcaaaaacgcgactatttttgagtgcccaagaggaagacgaa
cctgtattgctaaaggagatgcctgagacacccaaagtcatcaaagatgagaccaacctc
cttttcttcttggaaggtcatggcactaagaactacttcgagtcagtgacccacccaacg
ttatttattgctacaaagcaagaacacccagtgcacatggcaagggggcaaccgtctatc
actgattttgagatactcgaaaaccaaccttga

DBGET integrated database retrieval system