KEGG   Hipposideros armiger (great roundleaf bat): 109393900
Entry
109393900         CDS       T04661                                 

Gene name
NLRX1
Definition
(RefSeq) NLR family member X1
  KO
K12653  NLR family member X1
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04621  NOD-like receptor signaling pathway
hai04622  RIG-I-like receptor signaling pathway
hai05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hai00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    109393900 (NLRX1)
   04622 RIG-I-like receptor signaling pathway
    109393900 (NLRX1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    109393900 (NLRX1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:hai04054]
    109393900 (NLRX1)
Pattern recognition receptors [BR:hai04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   109393900 (NLRX1)
SSDB
Motif
Pfam: NACHT LRR_6 NOD2_WH AAA_16 AAA_22 DUF815 TsaE AAA_25
Other DBs
NCBI-GeneID: 109393900
NCBI-ProteinID: XP_019519150
LinkDB
Position
Un
AA seq 1021 aa
MPGRAGKEHRAGAFGNKRETPVGDGLWGLGNRIDGSVPWALTVSLTMRWSHPLPRTLWGL
GLGRAFQPADEHIPFLIHWICALKGECPLGPHRALIRHHGSSVGSRPPSGRHEQLFRSTP
AAEAIQQHRRNLAEWFSRLPREERQFGPTFALDTVHVDPVIRESTPDELLRPPSELALEH
PLPPARLPTLALSQLFDPDACGRRVQTVVLYGTVGTGKSTLVRKMVLDWCYGRLPAFELL
IPFSCEDLSSLGPAPASLCQLVAQRYTPLKEILPLMATTGSRLLFVLHGLEHLNLDFRLA
GTGLCSDPEKPEAPAAIIVNLLRKYMLPEARILVTTRPSAIGRIPSKYVGRYGEICGFSD
TNLQKLYFQLRLNQPDCEHSAGGMGVSATPAQRDNLVEMLSRNLEGHHQIAAACFLPSYC
WLVCATLHFLHAPTPAGQTLTSIYTSFLRLNFNGEMVDSTDPSKLSLMAYAARTMGKLAY
DGVSSRKTYFSEEDVHGCLEAGIRTEEEFQLLHVFRRDALRFFLAPCVEPEHPGTFVFTV
PAMQEYLAALYIVLGLRKTTLQRVGKEVAELVGRVGEDVSLVLGIVAKLLPLRVLPLLFN
LLKVVPRVFGHVVGKSREAVAQAMVLEMFREEDYYNDDVLDQMGASILGMEGPRCHPDEP
PEDEVFELFPMFMGGLLSAHNRVMLAQLGCPIKNLDALENAQAIKRKLGKLGRRVLPPSE
LLDHLFFHYEFQNQRFSAEMLSSLRQLNLAGVRMTPLKCTVVAAVLGSGKHVLEEVNLAS
CQLDPAGVRTLMPVFLRARKLGLQLNSLGPEACRDLRDLLLHDQCQITTLRLSNNPLTAA
GVALLVEGLAGNTSLTHLSLLHTGLGDEGLELLAAQLDRNQQLQELNVAYNGAGNTAALA
LAKAAWKHPSLELLHLYFNELSSEGRQVLRDLGGTAEGGARVVVSLTEGTAVSEYWSVIL
SEVQRNLNSWDQGRVRRHLELLLQDLEDNRGATLNPWRKAQLLRVEGEVRALLQQLGGPG
S
NT seq 3066 nt   +upstreamnt  +downstreamnt
atgccagggcgggcaggcaaggagcaccgcgctggggcctttgggaacaagcgggagact
ccggtgggcgacggactctggggcttggggaataggatagatggtagtgtgccctgggct
ctgaccgtctctcttaccatgaggtggagccaccctttgcccaggaccttatggggcctg
ggtctgggaagagcattccagccagcagatgaacatatccccttcctgatccactggatt
tgtgcacttaaaggggagtgtccccttgggccccatagagcccttatacgccaccatgga
agctcagtgggcagccggcccccatcagggaggcatgagcagttgttccggagcacccct
gccgctgaagccatccagcagcaccgccggaacctggccgagtggttcagccggctgccc
agggaagagcgccaatttggcccaacatttgcactagacactgtccatgtggatcctgtg
attcgcgagagcacccccgatgagctacttcgcccaccttcggagctggccctggagcat
ccgctgcccccggccaggctccccacactcgccctgtctcaactctttgacccagatgcc
tgtgggcgccgggttcagacagtggttctgtatgggacagtgggcacaggcaagagcaca
ttggtgcgcaagatggtcttggactggtgttacgggcggctgccagcctttgagctgctc
atccccttctcctgtgaggacctatcatccctgggtcctgccccggcctccttgtgccaa
cttgtggcccagcgctacacacccctgaaggagattctgcccctgatggccaccactggg
tctcgcctactctttgtgctccatggcttagagcatctcaaccttgacttccggctggca
ggcacagggctttgcagtgatcctgagaagccagaggcaccagctgccatcatagtcaat
ctgctgcgcaaatacatgctgcctgaggccagaattctggtgactacccgtccctctgcc
attggccgcatccccagcaaatatgtgggccgctatggcgagatctgtggcttctctgat
accaacctgcagaagctctattttcaactccgcctcaaccagccagactgtgagcacagt
gccgggggtatgggtgtctcagctacgccagctcagcgtgacaacctggtagagatgctc
tctaggaacctggaagggcaccaccagatcgccgctgcctgcttcctgccctcctattgc
tggcttgtctgtgccactttgcactttctgcatgcccctacaccagctggacagaccctc
acaagcatctacaccagcttcctgcgcctaaacttcaatggggagatggtggacagcact
gacccctctaagttgtccctgatggcctatgcagcccgaaccatgggcaagttggcctat
gacggggtatcttcgcgcaagacctacttctctgaagaagatgtccatggctgcctggaa
gctggcatcaggacagaagaggagtttcagctgttgcatgtcttccgccgggatgccctg
agattttttctggccccatgtgtggagccagagcacccgggcaccttcgtgtttactgtg
cctgccatgcaggaatatcttgctgccctctacattgtgttgggtttgcgtaagacaact
ctgcagcgggtgggcaaggaagtggctgagctcgtgggccgtgttggggaggacgtcagc
ctggtattaggcatcgtagccaagctgctgcccttgcgggtcctgcctctgctcttcaac
ttgcttaaggtggttccacgagtgtttgggcacgtggtgggtaagagccgcgaggcagtg
gcccaggccatggtgctggagatgttccgagaggaggattactacaatgacgatgtcctg
gaccagatgggtgccagtattctgggcatggagggcccccggtgccacccagatgagccc
cctgaggatgaggtctttgagctcttccccatgttcatgggagggcttctctctgctcat
aaccgggtcatgctggctcagcttggctgccctatcaagaacctggatgccctggagaat
gcccaggccatcaagaggaagctgggcaagctgggccggcgggtgctgcccccctcagag
ctccttgaccacctcttcttccactacgagttccagaatcaacgcttctctgctgagatg
ctcagctccctgcgccagctcaatctggcgggagtgcgcatgacacccctcaagtgcaca
gtggtagcagctgtactgggcagtggaaagcatgtcttggaagaggtgaacttggcctcc
tgccagctggaccctgctggggtgcgcacactcatgcctgtcttcctgcgtgcccggaaa
ctggggttgcaactcaacagtctgggccctgaggcctgcagggacctccgagacctgctg
ctgcatgaccaatgccaaattactaccctgcggctgtccaacaacccgctgacggctgca
ggtgtggctctgctggtagaggggctagcaggaaacacctcactgacacacctgtccctg
ctacacacgggccttggggacgagggcctggaactgctggctgcccagctggaccgtaac
caacaactacaggagctgaacgtggcctacaatggcgctggcaacacagcggccctggcc
ctggccaaggctgcctggaagcatccttccctcgagctgttgcacctctacttcaatgag
ctgagctcagagggccgccaggtcttgcgggacttggggggcactgctgaaggcggtgcc
cgggttgtggtatcactgacggaggggacagcagtgtccgagtactggtcggtgatcctc
agtgaagtccagcggaacctcaacagctgggatcagggccgggtgcggcgccaccttgag
ctattgctgcaggatctggaagataaccgaggagccactcttaatccctggcgcaaggcc
cagctgcttcgagtggagggagaggtcagggccctcctgcaacagctgggaggccctgga
agctga

DBGET integrated database retrieval system