KEGG   Halobacterium salinarum NRC-1: VNG_2404G
Entry
VNG_2404G         CDS       T00038                                 

Gene name
dip1
Definition
(GenBank) DNA damage-inducible protein
Organism
hal  Halobacterium salinarum NRC-1
SSDB
Motif
Pfam: MatE Polysacc_synt_C
Other DBs
NCBI-ProteinID: AAG20494
UniProt: Q9HMS7
LinkDB
Position
complement(1803013..1804554)
AA seq 513 aa
MSLRNRAQALLALFPAFLARLGLVDRRRGEEAFDLAVPAMVTGGLRTLLRTADFFMVSIA
TGSTAVAALEIGFQYYFIPFGLALALTSGTISVVSRFKGADDHAGANFAIKQSLWLALLV
SLPITAGTWVYADSMIGLLNSNPEIIELGAAYLRVVMLTVVFRFWGMTASRALAGAGDTR
TPMYVRLITLPTNIALNAVLIFGIWVFPELGVVGAAWGTAIANAVAGIVFFAVLLSGRWD
VTLSFSGKQWDWGVASEIVRVSLPLAGTRLSRTFGRFPFLFVLGLFSHQVVAAYAIGRRV
MLLALMPAWGYSTASSTLVGQQLGAGDPDEAAAYGWQTLRVALATQLIIGALLFVAAGPI
ASAFTPERFSLTVTFIRIFGLSVAGFSVARTLRGALRGAGDTRWPLYGGLIGTYIVRLPL
AFLALDPGQIISAGPWVIDATVHSLSVGPVTTPTIALGVLTIPGFTVAPGLGWGFAAIFL
AIVGDMYTRAAVNFVRFRSGAWRAYGTPTAAAD
NT seq 1542 nt   +upstreamnt  +downstreamnt
atgtctcttcgcaaccgcgcgcaggcactgctggcgctgttcccagcgttcctggcgcgt
ctcggtctcgtcgaccgtcgcaggggcgaggaggccttcgatctggctgtccccgcgatg
gtaaccggcggcctccggacgctgctgcggaccgccgacttcttcatggtgagtattgcc
actgggtcgaccgcggtcgccgccctcgaaatcggcttccagtactacttcattccgttc
gggctcgcgctcgcgctcacgtccggcacgatcagtgtcgtctcccggttcaagggtgct
gacgaccacgccggcgccaacttcgcgatcaagcagtcgctgtggctggcgttgctggtg
tcgttgcccatcaccgccggcacctgggtgtacgccgactcgatgatcgggttgctcaac
agcaaccccgagatcatcgagttgggtgcggcgtacctccgcgtggtgatgctgaccgtc
gtgttccggttctgggggatgacggcgtcgcgcgcgctcgccggtgccggcgacacccgg
acgccgatgtacgtccggctcatcaccctccccacgaacatcgcgttgaacgcggtgctc
atcttcgggatctgggtgttccccgagctgggcgtcgtcggcgccgcctgggggaccgcg
atcgccaacgccgtcgccggcatcgtgttcttcgccgtcctgctctccgggcgctgggat
gtcaccctctcgttcagcggcaagcagtgggactggggcgtcgccagcgagatcgttcgc
gtctccctcccgctggcgggcacccggctctcccggacgttcggccggttcccgttcctg
ttcgtcctcgggctgttcagccaccaggtggtcgccgcctacgccatcggccgccgcgtg
atgctgttggcgttgatgcccgcgtgggggtattcgacggcgtcatcgacgctcgtcggc
cagcaactcggcgccggcgaccccgatgaggcggccgcctacggctggcagacgctgcgc
gtcgcgctggccacccaactcatcatcggcgcgctgctgttcgtggctgcgggccccatc
gcgtccgcgttcacccccgagcggttctccctgaccgtgacgttcatccgcatcttcggg
ctcagcgtcgccgggttctccgtggcgcgcacgctccgcggcgcgctccgcggggccggc
gacacccgttggccgctgtacggcggactgatcgggacgtacatcgtccgcctcccgctg
gcgttcctggcgctcgaccccggacagatcatctccgccggcccgtgggtgatcgacgcc
accgtgcactcgctctccgtcggccccgtcaccacgccgacgatcgcgttgggcgtgctc
accatccccggtttcaccgtggcccccgggctcggctgggggttcgccgcgatcttcctg
gcgatcgtcggcgacatgtacacgcgcgccgcggtcaacttcgtgcgcttccggtcgggc
gcctggcgggcgtacggcacccccaccgcggccgccgactga

DBGET integrated database retrieval system