KEGG   Halobacterium salinarum NRC-1: VNG_1356G
Entry
VNG_1356G         CDS       T00038                                 

Gene name
fumC
Definition
(GenBank) fumarate hydratase
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Organism
hal  Halobacterium salinarum NRC-1
Pathway
hal00020  Citrate cycle (TCA cycle)
hal00620  Pyruvate metabolism
hal00720  Carbon fixation pathways in prokaryotes
hal01100  Metabolic pathways
hal01110  Biosynthesis of secondary metabolites
hal01120  Microbial metabolism in diverse environments
hal01200  Carbon metabolism
Module
hal_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hal_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VNG_1356G (fumC)
   00620 Pyruvate metabolism
    VNG_1356G (fumC)
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    VNG_1356G (fumC)
Enzymes [BR:hal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.2  fumarate hydratase
     VNG_1356G (fumC)
SSDB
Motif
Pfam: Lyase_1 FumaraseC_C
Other DBs
NCBI-ProteinID: AAG19688
UniProt: Q9HQ29
LinkDB
Position
complement(1011395..1012807)
AA seq 470 aa
MSEDYRTEQDSLGEMQVPADAYWGAQTQRAIENFPISGIAFGRRFVRALGVVKKAAAQAN
RDLGLVDDERADAIVAAADEVIAGEHDDQFPVDVFQTGSGTSSNMNANEVIANRAAELLG
EEIGDRVVHPNDHVNYGQSSNDVIPTAMHVASLDALVNDVKPGLETLAAELDDKADAFDG
VVKTGRTHLQDATPVRLGQEFGGYRTQVEKGIDRIEAVAPRLSELALGGTAVGTGLNTHP
EFPETAAGYISEETGVTFREADNHFEAQAAHDAMNEAHGALRTVAGSLNKIANDLRLLAS
GPRNGLGEIEQPENQPGSSIMPGKINPVVAEAVNQVHKQVVGNDAAIAAGAAEGQIDLNL
YKPVLAHNFLQSADMLANASAAFGEKFVAKLEANEAACEAQVERSMALATALNPTIGYDK
ASEVAKAALKEGKTVTEVVVEKGYLSEAEAADVLDPEGMTHRGILSGDDT
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgagcgaggattaccgcacggagcaggacagcctcggcgagatgcaggttcccgctgac
gcctactggggggcacagacccagcgcgcgatcgagaacttcccgatctcggggatcgcg
ttcgggcggcggttcgtgcgcgcgctcggcgtcgtcaagaaggccgccgcgcaggcgaac
cgcgacctcggcctcgttgacgacgagcgcgccgacgccatcgtcgcggccgccgacgag
gtcatcgccggcgagcacgacgaccagttcccggtcgacgtcttccagaccgggtccggg
acgtcctcgaacatgaacgccaacgaggtcatcgcgaaccgcgccgcggagctcctcggc
gaggagatcggggatcgcgtcgtgcaccccaacgaccacgtgaactatggccagtccagc
aacgacgtgatcccgaccgcgatgcacgtggcgagcctcgacgcgctcgtcaacgacgtc
aaacccggcctggagacgctggcagcggaactcgacgacaaagcggacgcgttcgacggc
gtcgtgaagaccgggcgcacgcacttgcaggacgccacgccggtgcggttgggccaggag
ttcggcggctaccgcacccaagtcgagaagggcatcgaccgcatcgaggccgttgccccg
cgcctctcggagctcgcgctcggcggcaccgccgtcggcaccgggctgaacacccacccc
gagttcccggagacggcggccggctacatcagcgaggagaccggcgttacgttccgtgag
gcggacaaccacttcgaggcgcaggccgcccacgacgccatgaacgaggcccacggcgcg
ctgcgcacggtcgcggggtcgctgaacaagatcgccaacgacctccggctgcttgcctcc
ggcccccgcaacgggctgggggagatcgagcagcccgagaaccagcccggctcctcgatc
atgcccgggaagatcaaccccgtggtggcggaggcggtcaaccaggtccacaagcaggtc
gtgggcaacgacgccgccatcgccgcgggggccgcggaggggcagatcgacttgaacctc
tacaagcccgtgctggcgcacaacttcctgcagtccgcggacatgctcgccaacgcgagc
gctgccttcggcgagaagttcgtcgccaagctcgaagccaacgaggccgcctgcgaggcg
caggtcgagcgctcgatggcgctggcgaccgcgctcaaccccacgatcggctacgacaag
gccagcgaggtcgcgaaggccgcgctgaaggaggggaaaacagtcacggaggtcgtcgtc
gagaagggatacctctcggaggcggaggccgctgacgtgctcgaccccgaggggatgacc
caccggggcatcctctccggcgacgacacgtag

DBGET integrated database retrieval system