KEGG   Halobacterium salinarum NRC-1: VNG_1726G
Entry
VNG_1726G         CDS       T00038                                 

Gene name
htlB
Definition
(GenBank) Htr-like protein
Organism
hal  Halobacterium salinarum NRC-1
SSDB
Motif
Pfam: EMC3_TMCO1 60KD_IMP DUF4199 DUF3881 DUF530
Other DBs
NCBI-ProteinID: AAG19964
UniProt: Q9HPA6
LinkDB
Position
1276763..1277635
AA seq 290 aa
MARTAEKVQSLVREDPEMATILEDLLDHDGDLQWQDVSDDVSSGQWGRLLEKDILVEGDT
GFEVGDPDGVEEGLAPDDDGDDDSPEGTSWSTYDKLAGVGAVGAMIGYSYSPIKNAIGGT
INVVLGPLDSIMPFYVVILVLAVLTGLYTTILQANLTDMEKMSKYQEQAQELQDKMSAAK
ERGDDAAVERLREEQMEAFGDQASMMKEQFRPMVWIMLLTIPVFLWMYWKLGTGTIPQSE
LNMVLPLLGEIDLNGGRVLVFPAWILWYMMCSFSFSNIIRKALNIQTTPT
NT seq 873 nt   +upstreamnt  +downstreamnt
atggcacgaaccgcggagaaagtacagtcgttggttcgcgaggaccccgagatggcgacg
atcctcgaagacctcctggaccatgacggcgacctccagtggcaggacgtcagcgacgac
gtttcgagcggccagtgggggcgcctcctggagaaagacatcctcgtcgagggcgacacg
gggttcgaggtcggtgaccccgacggcgtcgaggaggggcttgcacccgacgacgacggc
gacgacgacagccccgagggcacgtcgtggtcgacgtacgacaagctcgcgggcgtcggg
gccgtcggcgcgatgatcgggtacagttactcgccgatcaagaacgcgatcggcggcacg
atcaacgtcgtgttggggcccctggactcgatcatgcccttctacgtcgtgatcctggtg
ttggcggtgctgactgggttgtacacgacgatcctccaggcgaacctcacggacatggag
aagatgtcgaaataccaggagcaagcccaggagctccaggacaagatgtccgcggcgaaa
gagcgcggcgacgacgccgcggtcgaacgcctccgcgaggagcagatggaggcgttcggc
gatcaggccagcatgatgaaagagcagttccgcccgatggtgtggatcatgctgctgacg
atcccggtgttcctctggatgtactggaagctgggcacgggcacgatcccgcaaagcgag
ctcaacatggtgttgccgttgctgggtgagatcgatctcaacggcggccgcgtgctcgtg
ttcccggcgtggatcctctggtatatgatgtgctcgttcagcttctcgaacatcatccgg
aaggcgctgaacatccagacgacgcccacgtag

DBGET integrated database retrieval system