KEGG   Halobacterium salinarum NRC-1: VNG_2338G
Entry
VNG_2338G         CDS       T00038                                 

Gene name
polA2
Definition
(GenBank) DNA polymerase type II large chain
  KO
K02322  DNA polymerase II large subunit [EC:2.7.7.7]
Organism
hal  Halobacterium salinarum NRC-1
Pathway
hal03030  DNA replication
Brite
KEGG Orthology (KO) [BR:hal00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    VNG_2338G (polA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hal03032]
    VNG_2338G (polA2)
Enzymes [BR:hal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     VNG_2338G (polA2)
DNA replication proteins [BR:hal03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (archaeal)
    D-family DNA polymerases
     VNG_2338G (polA2)
SSDB
Motif
Pfam: PolC_DP2 Intein_splicing HypA TackOD1
Other DBs
NCBI-ProteinID: AAG20443
UniProt: Q9HMX8
LinkDB
Position
complement(1746166..1750278)
AA seq 1370 aa
MRPTDETYFETLETGLDDAFEVAEAARERGEDPTPNVEIPVAKDMADRVENILGIDGVAE
RVRDLDGEMSREEAALELVADFVDGRVGDYDTDAGKIEGAVRTAVALLTEGVVAAPIEGI
DRVEVNDNDDGTQYVAVYYAGPIRSAGGTAQALSVLVADYARAMLGIDAFKPRDDEIERY
AEEVDLYDSETGLQYSPKDAETTFITEHCPVMLDGEATGNEEVDGFRDLERIDTNSPRGG
MCLVLAEGIALKAPKIQRYTRNLDEVAWPWLQDLIDGTIGADDADEDTPDAGSDSDATDE
GDAPSASTDAEEPPRAAPSDKFLRDLIAGRPVFGHPSKNGGFRLRYGRARNHGNATAGVH
PATMHLLDDFLATGTQIKTERPGKAAGIVPVDSIEGPTVKLANGDVRHINDPADALDVRN
GVAEILDVGEYLVNYGEFVENNHELAPASYAPEWWIQDLDAAGADVQALRDSPYVDLTAP
TADQAMAWATDYDAPLHPAYTYLWHDIDVEQFRALADAVADAHTDASDDDDRGVLVLDHT
TTVRETLEALLVTHHQGDDTIRVDDWLPLARSLGVTESLDREWETLSEAAAEWPNAVRAV
NEVAPFSVQERAPTRIGNRMGRPEKSESRDLSPAVHTLFPIGDAGGSQRDVADAARYAPD
MSDTPGEIPVRVGDRVCPSCDEHTYESRCPDCGDWTDPHYECRDCGAVATPDESGRVECP
NCGRDLDNVTTQVIDINDEYHGALRAVGERENAFDQLKGVKGLLSAEKTPEPMAKGVLRA
KHDVTAFKDGTVRYDMTDLPVTAVTPAELDVTAGQFRELGYNQDIHGDPLEHDDQLVELR
VQDVVLSDGAADHMLKTADFVDDLLTQYYGLDAFYDLDDRDDLVGELVFGMAPHTSAAVV
GRVAGFTSASVGYAHPYFHAAKRRNCFHPETNVWFRDESGEWHHDPIETLVEARLDPDTA
DEDDFGALVQALDGDVFVPSVTEDGEETLQRVEAVSKHPAPDHLLAVETKRGRELTVTPD
HSMRRWTGDGIERVDARELTAGDALPAPTQVPGDGETATSELRSESLDGTHPQRRFGDGG
SVRTDEVVSVEPVRSSVDHTYSLTVAETNTLVANGLFTGQCDGDEDCVMLLMDGLINFSK
SYLPDKRGGRMDAPLVMSSRIDPAEIDDEAHNIDIDREYPREFYEATRELADPEDVADLI
TLAESTVGTDEEYTGFGHTHATSNIHLGPSLSAYKTLGSMMDKMDAQLELARKLRSVAET
DVAERVIEYHFLPDLIGNLRAFSRQETRCLDCGEKYRRMPLSGDCRECGGRVNLTVHEGS
VNKYMDTAMRVATEYDCREYTKQRLEIMDRRLESVFEDDTNKQSGISDFM
NT seq 4113 nt   +upstreamnt  +downstreamnt
atgcggcccaccgacgaaacctacttcgaaacgctggaaaccggcctcgacgacgccttc
gaggtcgcggaagccgcccgggaacgcggggaagacccgacgccgaacgtcgaaatcccg
gtcgcaaaggacatggccgaccgcgtcgagaacatcctcgggatcgacggcgtcgccgag
cgcgtccgcgatctcgacggcgagatgagccgcgaggaggccgcgctggagctcgtcgcg
gacttcgtcgacggccgcgtcggcgactacgacaccgacgccggcaagatcgagggcgcg
gtccgcaccgcggttgcactgctcactgagggcgtggtcgcggcccccatcgagggcatc
gaccgcgttgaagtcaacgacaacgacgacggcacccagtacgtcgcggtctactacgcc
ggccccatccggtcggccggcggcaccgcgcaggcgctctcggtgctcgtcgccgactac
gcgcgtgcgatgctcggcatcgacgcgttcaaaccccgcgacgacgagatcgagcgctac
gccgaggaggtcgatctctacgactccgagaccggtctccagtactccccgaaggacgcc
gaaaccacgttcatcaccgaacactgtccggtgatgctggacggcgaagcaaccggcaac
gaggaggtcgatgggttccgcgacctcgaacgcatcgacaccaactccccgcggggcggc
atgtgtctcgtgctcgcggagggcatcgcgctgaaagcccccaagatccagcgctacacc
cggaacctcgacgaagtcgcgtggccgtggctccaggacctcatcgacggcaccatcggc
gccgacgacgccgacgaagacaccccggacgccggcagcgacagcgacgcaaccgacgag
ggggacgcccccagtgcgagcaccgacgccgaggagccaccccgcgccgccccctcggac
aagttcctccgcgacctcatcgcgggccggccggtgttcggccatccctccaaaaacggc
gggttcaggctgcgctacgggcgtgcgcgaaaccacgggaacgcgaccgcgggcgtccac
ccggcgacgatgcacttgctcgatgacttcctcgcgacgggcacccagatcaagaccgaa
cgccccgggaaggccgcgggcatcgtccccgtcgactccatcgaggggccgacggtgaaa
ctcgccaacggcgacgtccgccacatcaacgaccccgcggacgccctcgacgtccgcaac
ggcgtcgcggagatcctcgacgtcggcgaatacctcgtgaactacggggagttcgtggag
aacaaccacgagctcgcgcccgcctcgtacgcccccgagtggtggattcaggacctcgac
gccgcgggcgcggacgtgcaagccctccgggactcgccgtacgtcgatctcaccgccccc
accgccgatcaagccatggcgtgggcgaccgactacgacgccccgctgcacccggcgtac
acgtacctctggcacgacatcgacgtcgagcagttccgcgcgctcgccgacgccgtcgcc
gacgcccacaccgacgccagcgacgacgacgaccgcggtgtgctcgtgctcgatcacacc
accaccgtgcgcgagacgctcgaagcgctcctggtcacccaccaccagggcgacgacacc
atccgggtcgacgactggctgccgctggcgcgctcgctcggcgtcaccgaatcgctcgac
cgggagtgggagacgctctctgaggccgccgccgagtggcccaacgccgtccgcgcggtc
aacgaagtcgcgccgttcagcgtccaggagcgcgcccccacacgcatcgggaaccgcatg
ggccgccccgagaaatccgaatcccgcgatctctcgccggccgtccacaccctgttcccc
atcggcgacgccggcggcagccagcgcgacgtcgccgacgccgcgcggtacgcgccggac
atgtccgacacgcccggcgaaatccccgtccgggtcggcgaccgcgtctgtccgtcctgc
gacgagcacacctacgaatcgcggtgccccgactgcggggactggaccgacccccactac
gagtgccgggactgcggtgccgtcgccacccccgacgagtccgggcgcgtcgaatgcccg
aactgcgggcgggacctcgacaacgtcaccacacaggtcatcgacatcaacgacgaatac
cacggcgcgctccgcgccgtcggcgagcgcgagaacgccttcgaccaactcaaaggcgtc
aagggactgttatccgcggagaaaacccccgaacccatggcgaaaggcgtcctgcgcgcg
aaacacgacgtcaccgcgttcaaggacggcactgtccgctacgacatgaccgacctcccg
gtgaccgccgtcacacccgcggagctcgacgtcactgccgggcagttccgcgaactcggc
tacaaccaggacatccacggcgaccccctcgaacacgacgaccaactggtcgaactccgc
gtgcaggacgtggtgctctccgacggcgcggccgaccacatgctcaagaccgcggacttc
gtcgacgacctcctcacccagtattacggcctcgacgccttctacgacctcgacgaccgc
gacgatctcgtcggcgaactcgtcttcggcatggcaccccacacgtcggccgccgtcgtc
ggccgcgttgccggcttcacctccgcgtccgtcggctacgcccacccctacttccacgcc
gcgaaacgccggaactgcttccacccggagacgaacgtctggttccgcgacgagtccggg
gagtggcaccacgacccgatcgagacgctcgtcgaggcgcgactcgatcccgacacggcc
gacgaggacgacttcggagccctcgtgcaggccctcgacggcgacgtgttcgtgccctcg
gtgaccgaggacggcgaggagaccctccagcgagtcgaagccgtctccaaacaccccgcc
ccggaccacctcctcgcggtcgagacgaaacgcggccgggaactgaccgtgacccccgac
cactcgatgcgtcggtggaccggggacggcatcgaacgcgtcgacgcccgggaactgacg
gcgggcgacgctctccccgcaccgacacaggttccgggcgacggcgagacggcgacgtcc
gagctgcgttccgagtccctggacggcacacacccgcagcgacgcttcggtgacggcggc
agcgtccggaccgacgaggtcgtgtccgtcgaaccggtccgatccagcgtcgaccacacg
tactccctgaccgtcgcggagaccaacacgctcgtcgcaaacggcctgttcaccgggcag
tgcgacggcgacgaggactgcgtgatgctgctgatggacggcctgatcaacttctcgaag
tcgtacctgccggacaagcgcggcggccggatggacgcgccgctggtgatgtcctcccgc
atcgaccccgcggagatcgacgacgaagcccacaacatcgacatcgaccgcgagtacccc
cgggagttctacgaggcgacccgggagctggccgaccccgaggacgtggcggacctcatc
accctcgcggagtcgacggtcggcaccgacgaagagtacaccggcttcgggcacacccac
gccacctccaacatccacctggggccgtcgctgtcggcgtacaagaccctggggtcgatg
atggacaagatggacgcccaactggagttggcccgcaaactccggtcggtcgccgaaacc
gacgtcgccgaacgcgtcatcgagtaccacttcctcccggacctcatcgggaacctgcgc
gcgttcagccgccaggaaacccggtgtctggactgtggggagaaataccgccgcatgccg
ctcagcggcgactgccgggagtgcggtgggcgcgtgaacctcacggtccacgagggttcc
gtaaacaagtacatggacaccgccatgcgggtcgccaccgagtacgactgccgggagtac
acgaaacagcgcctcgaaatcatggaccgacgcctggaatccgtcttcgaggacgacacc
aacaagcaaagcggcatctccgatttcatgtga

DBGET integrated database retrieval system