KEGG   Halobacterium salinarum NRC-1: VNG_1797G
Entry
VNG_1797G         CDS       T00038                                 

Gene name
thrB
Definition
(GenBank) homoserine kinase
  KO
K00872  homoserine kinase [EC:2.7.1.39]
Organism
hal  Halobacterium salinarum NRC-1
Pathway
hal00260  Glycine, serine and threonine metabolism
hal01100  Metabolic pathways
hal01110  Biosynthesis of secondary metabolites
hal01120  Microbial metabolism in diverse environments
hal01230  Biosynthesis of amino acids
Module
hal_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hal00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VNG_1797G (thrB)
Enzymes [BR:hal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.39  homoserine kinase
     VNG_1797G (thrB)
SSDB
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Other DBs
NCBI-ProteinID: AAG20015
UniProt: Q9HP55
LinkDB
Position
complement(1329752..1330657)
AA seq 301 aa
MVVTVRAPATSANLGSGFDVFGVALSKPADVVRVERADTTTITVTGAGAQYVPTDPQENT
AGVVAAALDAPATIHINKGVRPSSGLGSSAASAAAATVALAELYDRPLDDDALVRAAAQG
EAAASGVAHADNVAPAILGGFTIVREDGIEHVDASLALAVCLPETTVSTRDARGVVPESA
AMEAVVSTVESAATLTLGMCENDPQRVGRGVEDALVTPARARLMDGYEAASAAARDAGAT
GVTISGSGPGVVAVCRRRDRKRVAAALVDGFDSAGVAASAYQTRIGDGATRLAADGDDRA
P
NT seq 906 nt   +upstreamnt  +downstreamnt
atggttgtcacggtgcgtgcgcccgcgacgagcgcgaatctcggcagcgggttcgacgtg
ttcggggtcgcgttgtcgaagcccgccgatgtcgttcgagtcgagcgcgccgacacaacg
acaatcactgtcaccggggcgggcgcacagtacgtgcccaccgacccacaggagaacacc
gccggcgtcgtcgccgcagcgctcgacgcgccggccacgatccacatcaacaagggcgtg
cggccgtcctccgggctggggtcgtcggcggccagcgcggcggccgcgaccgtcgcgctc
gcggagctgtacgaccgcccgctcgacgacgacgcgctcgttcgcgcggccgcccagggg
gaggcggcggcgtccggcgtcgcgcatgccgacaacgtcgctcccgccattctcggtggg
ttcaccatcgtccgcgaggacggcatcgagcacgtcgacgccagcctcgcgcttgcggtc
tgcctgccagagacgaccgtctcaacgcgcgatgcgcgcggcgtcgtccccgagtcggcg
gccatggaggccgttgtctccaccgtggagtcggccgccacgctcacgctcggcatgtgt
gaaaacgacccacagcgggtcggccgcggcgtcgaggacgcactcgtcacgccggcgcgt
gcccgactcatggacgggtacgaggcggcgtccgcggccgcccgcgacgccggtgcgacc
ggcgtgacgatcagcggctccgggccgggcgttgtggcggtctgtcgtcggcgcgaccgc
aagcgcgtcgccgccgcgctcgtggacggcttcgattcggcgggggtcgctgcgtcggcc
taccagacgcgcatcggcgacggtgccacacggctggcagccgatggtgacgaccgcgcg
ccgtga

DBGET integrated database retrieval system