Halorhabdus sp. CBA1104: Hrd1104_12845 Help Entry Hrd1104_12845     CDS       T06289                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism hala  Halorhabdus sp. CBA1104 Pathway hala03010   Ribosome Brite KEGG Orthology (KO) [BR:hala00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     Hrd1104_12845  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:hala03011]     Hrd1104_12845    04121 Ubiquitin system [BR:hala04121]     Hrd1104_12845   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hala04147]     Hrd1104_12845 Ribosome [BR:hala03011]  Ribosomal proteins   Eukaryotes    Small subunit     Hrd1104_12845   Archaea     Hrd1104_12845 Ubiquitin system [BR:hala04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    Hrd1104_12845 Exosome [BR:hala04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Hrd1104_12845   Exosomal proteins of colorectal cancer cells    Hrd1104_12845 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 FYVE zf-ribbon_3 Ribosomal_L37e Zn_Tnp_IS1595 zinc_ribbon_9 TF_Zn_Ribbon RNA_POL_M_15KD RPA_interact_C OrfB_Zn_ribbon Auto_anti-p27 zf_UBZ Motif Other DBs NCBI-ProteinID:  QGN08094 UniProt:  A0A650A6Y3 LinkDB All DBs Position 2572557..2572691 Genome browser AA seq 44 aa AA seqDB search MARYDFYNEDGTTDQETCPRCGDAFLAEHSDRTHCGRCGYTEWH NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atggcgcgatacgacttctacaacgaagacggcacgaccgatcaagagacctgtccgcgg tgtggcgacgcgttcctcgccgagcacagcgaccgcacacactgtggccgctgtggctac accgagtggcactaa

DBGET integrated database retrieval system