KEGG   Halodesulfurarchaeum formicicum HTSR1: HTSR_0841Help
Entry
HTSR_0841         CDS       T04517                                 

Gene name
glpA
Definition
(GenBank) anaerobic glycerol-3-phosphate dehydrogenase subunit A
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
halh  Halodesulfurarchaeum formicicum HTSR1
Pathway
halh00564  Glycerophospholipid metabolism
halh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:halh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    HTSR_0841 (glpA)
Enzymes [BR:halh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     HTSR_0841 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_2 Pyr_redox_2 Fer2_BFD GIDA FAD_oxidored HI0933_like Pyr_redox_3 Pyr_redox NAD_binding_8 Amino_oxidase FAD_binding_3 DAO_C NAD_binding_7 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AOW80027
UniProt: A0A1D8S3V5
LinkDB All DBs
Position
783732..786587
Genome map
AA seq 951 aa AA seqDB search
MGKRVVVVGGGVTGVGVARDLAMRGADVTLLERDRLAGGTSGRMHGLLHSGARYALSDPD
AAEECLHENAILREIASHCIEDTGGLFVSLPEDDPDYYDSKLAACRELGIPTDELSPEAA
RELEPALSTDLDRAFRVPDGAIDPFRLIVANAKSAANHGAKIETDTPVTGLLVEDGQVVG
VRTGDERTIRANHVVNAAGPWAGQLFADLAVDVPLAPAQGAMAVTNARPVETVINRCRPT
DEGDILVPHETTAILGTTDRAIDGPDAISETREEIELLREELAKLVPELADTRLIRTYWG
VRPLYDPDEGGASGRDFAVLDHGERDDLPGVTTVVGGKLTTYRLMAEAVSDAVAEKLGLD
APCRTAEEPLPGSGDRPGWEAVASRYDLRNPVAHRTATRLGDRTEPVLDDAQPNPVVCEC
EGVTDAEIRDAIRDVGADLDGVRSRTRATMGPCQGGVCAHRIAGVLAEAVGSDPAWSELS
SLVAERDRGQRHLDSPAQRAQIERNRLRRGRLLNLAAGKASDGLPLGDFATGTASAAGHS
SQEYGQSSPTTGPQDVIVYGGGLAARLAALAAAQEGVSVALLTPDSLTPDGFTGMVDLLG
SLPGDTGLVADPIPAVDSLPDSHPLRRAGAAGVREALDRFDAVVGSTLAGSATERNGLVS
SPVGTPLPVARYPPSFEPGLLSRRSDTLLVGFESIPDFPAKFAAETLSNRVPYAVRGATI
ELCATAPERPVRRLARALDRNERWPSDEPIRSTLAQVLDRVHEGESRIGLPSMLGIEATF
EIRSELSTQLGAKVFELPVPAPSAAAIRLSDRLDAQLRAHGVEVRQRVEDLALAGQARIE
AVDVQNGPRYEASQVVLATGGVAAGGLTTDRSGVQEPTFGLPVEHQTDHQAGLAVDPDWR
PGANGVICHPNLRAAGSILGGFDPATEHSRAGVEIVTGVQAGLAAAREVTR
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaacgggtcgtggtcgtcggcggcggggtcaccggggttggcgtcgctcgcgac
ctggcgatgcgtggcgcggacgtaactctcctggagcgggatcgactggctggcggcacc
tcgggtcggatgcacggtctgctccacagcggggctcgctacgccctctctgatccggat
gcggccgaggagtgtctccacgagaacgccatcctccgggagattgcgagtcactgcatc
gaggacactggcggactcttcgtctccctccccgaggacgatcccgactattatgactcg
aagctggctgcttgccgcgagctgggcattccgaccgacgaactctcgcccgaagccgcc
cgtgaactcgaacctgctctgagtaccgacctcgaccgtgcctttcgcgttccggacgga
gcgatcgatcccttccggctgatcgtcgcgaacgcgaagagcgcggcgaatcacggtgcg
aaaatcgagaccgacaccccggtcaccggattgctggtcgaagacggccaggttgttggg
gtgcgaaccggggatgagcgcaccattcgggccaaccacgtcgtcaacgccgctggcccc
tgggcggggcaactcttcgccgacctcgcggtcgacgttccgctcgcgccggcccagggg
gcgatggcggtgacgaacgctcgcccggtcgagacggtgatcaatcgctgtcgaccaact
gatgaaggagacatcctcgtcccccacgagacgacggcgatcctgggcaccaccgacaga
gcgatcgacgggccggatgcgatcagcgagacgcgtgaggaaatcgaactgcttcgcgag
gaactggcgaagctggtcccggaactggctgacacgcgactcatccggacctactggggc
gtgcgaccgctctacgatcccgacgaggggggtgcgtcggggcgggatttcgcggtcctc
gatcacggcgagcgcgacgacttgcccggggtgacgacggtggtcgggggcaagctgacc
acctaccggctgatggccgaggccgtctcggacgcggtcgcggagaagttgggcctcgac
gccccctgccgaacggccgaggaacccttgccaggcagtggcgaccggcctggctgggaa
gccgtcgcctcgcggtacgacctccgcaatccagtcgcccaccggaccgcaacccggttg
ggggaccgcacggagccagttctcgacgatgcccagcccaatcccgtcgtctgtgagtgt
gaaggcgtcacggacgccgagatccgtgacgcgattcgggacgtgggtgccgacctcgac
ggcgtgcgctcgcgcacccgggcgaccatggggccctgccagggcggggtctgtgcccat
cgaatcgccggcgtgctcgccgaggcggtcggatcggacccggcttggtcggaactctcc
tcgttggtggccgaacgcgaccggggccagcgccatctcgattctcccgcccagcgggcc
cagatcgagcgcaaccgactccgacgcggccggctcctgaacctggcggcaggaaaggcc
agcgacgggctccctctcggggacttcgcgacggggacggcgtcggccgcaggccactcc
tcccaggagtacggccagtccagccccacgactggcccgcaggacgtgatcgtctacggt
ggcgggctcgcggcgcggctggccgcgctcgcggctgcccaggaaggggtgtcggtcgcg
ttgctgactcccgactcgctcacgccggatgggttcactggaatggtggacctcctgggc
tcgcttcccggggataccggattggtggccgaccccatccccgccgtcgactcgctcccc
gattctcatccgttgcggagggcaggcgctgcgggggttcgcgaggcgctcgaccgcttc
gacgcggtggtgggatcgaccctcgctgggagcgccacggagcggaacggcctggtttcc
tccccagtcggaacgccgctacctgtggcccgctatccgccgagtttcgagcccggactg
ttgtccaggcgatcggataccctgctcgtcggcttcgaatcgattcccgatttcccggcg
aaattcgcggccgagacgctctcgaatcgcgtcccgtacgcggtccggggggccactatc
gaactctgcgcgacggcacccgagcggcctgtcagacgactcgcccgggccctggaccgg
aatgaacgctggccgagtgacgagccgattcgctcgaccctggcacaggtactcgaccgg
gtccacgagggcgagagccgaattggactgccgtcgatgctcgggatcgaggcaaccttc
gaaattcggagcgaactctccacacagctcggggccaaggtcttcgagctcccggtcccg
gcccccagcgcggccgcgatcagactgagcgaccggctcgacgcgcaactgcgcgcacac
ggggtcgaggtcagacaacgcgtcgaggacctggccctcgcgggccaggcccggatcgag
gccgtcgacgtgcaaaatggtccccgatacgaagccagccaggtcgtcctcgcgaccggt
ggggtggccgccggggggctgaccacggaccgatcgggcgtccaggaacccacgtttggc
ctgccagtcgagcaccagaccgaccaccaggcgggactggcggtcgatccggactggcgg
cccggagcaaacggcgtgatctgccatcccaacctccgggccgcgggctcgattctgggt
ggtttcgacccggccaccgagcactcccgggccggcgtcgaaatcgtcaccggcgtgcag
gccgggctggccgcggcccgggaggtgacgcgatga

DBGET integrated database retrieval system