Halodesulfurarchaeum formicicum HTSR1: HTSR_1919 Help Entry HTSR_1919         CDS       T04517                                  Symbol rps27ae Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism halh  Halodesulfurarchaeum formicicum HTSR1 Pathway halh03010   Ribosome Brite KEGG Orthology (KO) [BR:halh00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     HTSR_1919 (rps27ae)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:halh03011]     HTSR_1919 (rps27ae)    04121 Ubiquitin system [BR:halh04121]     HTSR_1919 (rps27ae)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:halh04147]     HTSR_1919 (rps27ae) Ribosome [BR:halh03011]  Ribosomal proteins   Eukaryotes    Small subunit     HTSR_1919 (rps27ae)   Archaea     HTSR_1919 (rps27ae) Ubiquitin system [BR:halh04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    HTSR_1919 (rps27ae) Exosome [BR:halh04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    HTSR_1919 (rps27ae)   Exosomal proteins of colorectal cancer cells    HTSR_1919 (rps27ae) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 FYVE RNA_POL_M_15KD FlhC HypA Motif Other DBs NCBI-ProteinID:  AOW81083 UniProt:  A0A1D8S6V2 LinkDB All DBs Position 1836971..1837102 Genome browser AA seq 43 aa AA seqDB search MARGDFYEDGELAKERCPRCEDAFLADHDDRKHCGRCGYTEWK NT seq 132 nt NT seq  +upstreamnt  +downstreamnt atggctcgcggcgatttctacgaggacggcgaactcgcgaaggaacgctgccctcgctgt gaggacgcgttcctcgccgaccacgacgaccgcaagcactgcggtcgctgtggctacacc gagtggaagtga

DBGET integrated database retrieval system