KEGG   Halomonas sp. 1513: BWR19_14050Help
Entry
BWR19_14050       CDS       T04761                                 

Definition
(GenBank) ATPase
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
halo  Halomonas sp. 1513
Pathway
halo02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:halo00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BWR19_14050
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:halo02000]
    BWR19_14050
Transporters [BR:halo02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    BWR19_14050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_29 Mg_chelatase AAA_22 AAA_16 AAA_25 AAA_27
Motif
Other DBs
NCBI-ProteinID: APX93964
UniProt: A0A1P8R5N8
LinkDB All DBs
Position
3093761..3094570
Genome map
AA seq 269 aa AA seqDB search
MLEIRQLALDFLRYRGLWRREAVACLHDVSLTLTRGEVHAVVGASGAGKSLMAQAMMGLL
PGNTRRRGELWLDGEPLDAARQAALRGKRLALIPQSLAALDPLVRSQRQVAWAAQRAGAA
APRAAAERALAQLGLVGDSARRYPHQLSGGMARRVLLAMATAGDAEWLIADEPSVGLDPQ
QRDGVLDQLRELADAGKGVLLITHDLRHALRVADRVTVFHAGTTLETAPADAFQGCGEAL
ASDYARALWRALPDNDFARPSLHEVAQLA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgctcgagatccgccagctcgccctcgacttcctgcgctaccgcggcctatggcgccgc
gaggcggtcgcctgcctgcacgacgtatcgctgacgctgacccgcggcgaagtgcacgcc
gtggtgggcgcctccggggccggcaagagcctgatggcccaagccatgatggggctactg
cccggcaacacccggcgccgcggtgagctgtggctcgacggcgagccgcttgacgcggcg
cgccaggcggcgctgcgcggcaaacgtctggcgctgattccccagtcgctggcggcgctg
gatccgctggtacgtagccagcgtcaggtcgcctgggcggcacagcgtgccggcgccgcc
gcaccgcgggcggccgccgaacgcgccctggcgcagctcggcctggtcggcgacagcgct
cggcgctacccccaccagctctccggcggcatggcgcggcgggtgctgctggccatggcc
accgccggcgacgccgagtggctgatcgccgacgagcccagcgtcggcctcgacccgcag
cagcgcgacggcgtgctcgaccagctgcgcgagctagccgacgccggcaagggcgtgctg
ctgatcacccacgacctgcgccatgcgctgcgcgtggccgaccgggtcacggtgttccac
gccggcaccaccctggaaaccgcgccggcggatgccttccagggttgtggcgaggcgctg
gccagcgactacgcccgggcgctttggcgggccctgcccgacaacgatttcgctcggccg
tcgctgcacgaggtcgcccagcttgcttga

DBGET integrated database retrieval system