KEGG   Hafnia alvei: AT03_18545Help
Entry
AT03_18545        CDS       T03425                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
hav  Hafnia alvei
Pathway
hav00250  Alanine, aspartate and glutamate metabolism
hav00280  Valine, leucine and isoleucine degradation
hav00310  Lysine degradation
hav00410  beta-Alanine metabolism
hav00640  Propanoate metabolism
hav00650  Butanoate metabolism
hav01100  Metabolic pathways
hav01120  Microbial metabolism in diverse environments
Module
hav_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:hav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AT03_18545
   00650 Butanoate metabolism
    AT03_18545
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AT03_18545
   00280 Valine, leucine and isoleucine degradation
    AT03_18545
   00310 Lysine degradation
    AT03_18545
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT03_18545
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hav01007]
    AT03_18545
Enzymes [BR:hav01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AT03_18545
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     AT03_18545
    2.6.1.48  5-aminovalerate transaminase
     AT03_18545
Amino acid related enzymes [BR:hav01007]
 Aminotransferase (transaminase)
  Class III
   AT03_18545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AIU74199
UniProt: A0A097R643
LinkDB All DBs
Position
complement(4037252..4038535)
Genome map
AA seq 427 aa AA seqDB search
MSTNKELMQRRSNAIPRGVGQIHPIFAERAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
KVVAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNKRVPGDFDKKTLLVTTGSEAVENAVK
IARAATKRSGTIAFSGAYHGRTHYTLSLTGKVNPYSAGMGLMPGHVFRALYPCELHGVSD
DDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYSTSPAFMKRLRELCDEHGIMLIADE
VQSGAGRTGTLFAMEQLGVAADLTTFAKSIAGGFPLAGVTGKAEIMDAIAPGGLGGTYAG
SPIACAAALAVLETFDEENLLQRANDVGQKLKEGLLNIAETHPEIGDVRGLGAMIAIELF
ENGDVHKPNAKLTAEVVARARDKGLILLSCGPYYNVLRILVPLTVSDAQIKQGLDIIAEC
FTEAKKN
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgaataaagaactgatgcagcgccgtagtaacgccattccacgcggcgttggg
cagattcatccgatttttgccgagcgagcagaaaactgccgcgtatgggacgtcgaagga
cgtgagtatctagactttgccggtgggattgcggttctgaatacgggccatttgcatcca
aaagtggtggctgcggttgaagctcagctgaagaagctgtcgcatacctgtttccaagtg
ttggcctacgaaccgtatttggaactgtgcgaaatcatgaacaagcgcgttccgggcgat
tttgacaagaaaacgctgctggtgacaacgggttctgaagcggtagaaaatgcggtgaag
attgccagagcggctaccaagcgcagcggaaccatcgcgtttagcggtgcttatcatggg
cgtactcattacaccttgtcgttgaccggcaaagtaaacccttactcagcaggtatggga
ttaatgccagggcacgtattccgcgctttgtatccttgtgaattacacggtgtcagcgac
gatgatgcgattgccagcattcatcgcattttcaaaaacgacgctgcgccggaagatatt
gccgccatcgttatcgaaccggtgcagggggaagggggattctattcaacgtcacctgcc
tttatgaaacgtctgcgcgaactgtgtgatgagcatgggatcatgctgattgctgatgaa
gtacaaagcggcgcagggcgtaccggaacattgtttgcgatggaacagttaggcgttgct
gccgatctcaccacctttgcgaaatctatcgcgggtggtttccctctcgcgggcgtgaca
ggcaaagccgagatcatggatgccatcgcgccgggcggtctgggcggaacctatgccggt
agccccattgcctgtgcggcagcgctggcggtgcttgaaacctttgatgaagaaaatctg
ttgcagcgcgccaacgatgtaggacagaaactgaaagagggcctgctcaatatcgctgaa
actcatccagaaattggtgatgtgcgtggtcttggcgcaatgattgcgattgagctgttc
gaaaacggcgatgtgcataaaccgaatgccaaactgacggcagaagtggtggcgcgggcg
cgtgataaggggctcatcctgttgtcatgcgggccgtactataacgtgctgcgtattttg
gttccgctcacggtgagtgacgcgcagatcaaacagggtctggatattatcgccgaatgt
tttaccgaggctaagaaaaactaa

DBGET integrated database retrieval system