KEGG   Halomonas chromatireducens: LOKO_01241Help
Entry
LOKO_01241        CDS       T04292                                 

Gene name
accC
Definition
(GenBank) Biotin carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
hco  Halomonas chromatireducens
Pathway
hco00061  Fatty acid biosynthesis
hco00620  Pyruvate metabolism
hco00640  Propanoate metabolism
hco01100  Metabolic pathways
hco01110  Biosynthesis of secondary metabolites
hco01120  Microbial metabolism in diverse environments
hco01130  Biosynthesis of antibiotics
hco01200  Carbon metabolism
hco01212  Fatty acid metabolism
Module
hco_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:hco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LOKO_01241 (accC)
   00640 Propanoate metabolism
    LOKO_01241 (accC)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    LOKO_01241 (accC)
Enzymes [BR:hco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     LOKO_01241 (accC)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     LOKO_01241 (accC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C ATP-grasp Dala_Dala_lig_C ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: AMD00309
UniProt: A0A120JVU8
LinkDB All DBs
Position
complement(1296827..1298161)
Genome map
AA seq 444 aa AA seqDB search
MLDKVLIANRGEIALRILRACKELGIKTVAVHSKADRELMHVRLADEAVCIGPASSAQSY
LNIPALISAAEVTDSSAIHPGYGFLSENANFAEQVERSGFVFIGPRAETIRLMGDKVSAI
EAMQIAGVPTVPGSDGPLGDDEGEIIAIARRIGYPVIIKAAAGGGGRGMRVVHTEAHLLS
AVNVTRTEAHSSFGDGTVYMEKFLEKPRHVEVQVLADGQGNAIHLFDRDCSLQRRHQKVL
EEAPAPGIDPEARARVLEACRQACIEINYRGAGTFEFLYEDGEFFFIEMNTRVQVEHPVT
EMVTGVDIVREQLRIASGLPLSIAQEDVKIHGHAFECRINAEDARTFMPSPGKVTLYHPP
GGLGVRMDSHLYTGYTVPPHYDSLIGKLITWGDSREIALTRMRNGLDELLVEGIKTNIDL
HKDLVRDGYFQQGGVNIHYLEKKR
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgctggacaaggttctcatcgccaaccgcggcgagatcgctctgcgtatcctgcgtgcc
tgcaaggagctgggcatcaagaccgtggccgttcactccaaggcagaccgtgaactgatg
cacgtgcgactggccgacgaggccgtgtgtatcgggccggcttcctcggcacagtcctat
ttgaacatcccggcgttgatcagcgctgcggaggtcaccgattccagcgccatacacccc
ggctacggctttctctccgagaacgccaactttgccgagcaggtggaacgctccggtttc
gtctttatcgggccccgggccgagaccattcggctgatgggcgacaaggtcagcgccatc
gaggcgatgcagatcgccggcgtgccgacggtacccggctcggacggcccgctgggcgat
gacgaaggcgagatcatcgccatcgctcgacgcataggttacccggtgatcatcaaggcc
gccgccggcggtggcggtcgcggcatgcgcgtggtacacaccgaggcccacctgctttcc
gccgtcaacgtgacacgcaccgaggcgcactcctctttcggggacggtaccgtctacatg
gagaagtttctcgagaagccgcgccatgtcgaggttcaggtgctggccgacggccagggc
aacgccatccacctctttgaccgcgactgctcgctgcagcgacgccaccagaaggtactg
gaagaggcccctgcgcccggtatcgaccctgaggcacgcgcccgggtactggaagcgtgc
cggcaggcctgcatcgagatcaactatcgcggtgccggaaccttcgagtttctctacgag
gacggcgaattcttcttcatcgagatgaacacccgtgtccaggtggagcatccggtcacc
gaaatggtgacgggggtcgatatcgtacgcgagcagcttcgcatcgcttccggcctgccg
ctgtcgatcgctcaggaagacgtcaagatccatgggcacgccttcgagtgccgcatcaac
gccgaggatgcgcgcaccttcatgccctccccgggcaaggtgacgctctaccaccccccc
ggcggcctcggtgtgcgcatggactcgcatctctataccggctatacggtaccgccccac
tacgactcgctgatcggcaagctgatcacctggggcgacagccgggagatcgccctgacg
cgcatgcgcaatggactcgacgaactcctggtggaaggcatcaagaccaatatcgatctg
cacaaggatctggttcgcgacggctacttccaacagggcggcgtcaacatccactacctg
gagaagaagcgctag

DBGET integrated database retrieval system