KEGG   Halomonas chromatireducens: LOKO_03100Help
Entry
LOKO_03100        CDS       T04292                                 

Gene name
pstB
Definition
(GenBank) Phosphate import ATP-binding protein PstB
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
hco  Halomonas chromatireducens
Pathway
hco02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:hco00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    LOKO_03100 (pstB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hco02000]
    LOKO_03100 (pstB)
Enzymes [BR:hco01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     LOKO_03100 (pstB)
Transporters [BR:hco02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    LOKO_03100 (pstB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_22 AAA_23 RsgA_GTPase AAA_29 AAA_15 AAA_16 AAA_33 AAA AAA_25 Rad17 cobW
Motif
Other DBs
NCBI-ProteinID: AMD02147
UniProt: A0A120JWL4
LinkDB All DBs
Position
complement(3307935..3308750)
Genome map
AA seq 271 aa AA seqDB search
MTTMTSAMTTASHRDAMLGMGKTTFKVRDLNLFYGKDQALKGIDLDIPANKVTAFIGPSG
CGKSTLLRCFNRMNDLVDICRIEGEILLDDENIYARGVDVAELRRKVGMVFQKPNPFPKS
IYENVAYGLRLQGVNSKSVLDEVVERSLRGAALWDEVKDRLGDNAFGLSGGQQQRLVIAR
AIAIEPEVILLDEPASALDPISTLKIEELIHELKEQYTILIVTHNMQQAARVSDYTAFMY
LGDLVEFGETNTIFTEPEKKQTEDYITGRYG
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgactaccatgacgtcagccatgaccaccgccagccatcgcgacgccatgctcggcatg
ggcaagaccaccttcaaggtgcgcgacctcaacctgttctacggcaaggaccaggcgctc
aagggcatcgacctggatatcccggccaacaaggtgaccgcctttatcggcccctcgggc
tgcggcaagtcgaccctgctgcgctgcttcaaccgcatgaacgacctggtcgacatctgc
cgcatcgagggcgagatcctgctcgacgacgagaatatctacgcccgcggcgtggatgtc
gccgagctgcgccgcaaggtgggcatggtgttccagaagcccaatccctttcccaagtcg
atctacgagaacgtcgcctacggcctgcgcctgcagggcgtcaacagcaagtcggtgctc
gacgaggtggtcgagcgctcgctgcgtggcgcggcgctgtgggacgaggtcaaggaccgg
ctcggcgacaacgccttcggcctctccggcggccagcagcagcgcctggtgatcgcccgg
gccatcgccatcgagccggaggtgatcctgctcgacgaaccggcctcggcgctggacccg
atctcgacgctgaagatcgaggaactgatccacgagctcaaggagcagtacaccatcctc
atcgtcacccacaacatgcagcaggcggccagggtctccgactacacagccttcatgtac
ctgggcgacctcgtcgagttcggcgagaccaacaccatcttcaccgagcccgagaagaag
cagaccgaggattacatcaccggacgctatggatga

DBGET integrated database retrieval system