KEGG   Hippocampus comes (tiger tail seahorse): 109522291
Entry
109522291         CDS       T04969                                 

Definition
(RefSeq) G1/S-specific cyclin-D3-like isoform X1
  KO
K10152  G1/S-specific cyclin-D3
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04110  Cell cycle
hcq04115  p53 signaling pathway
hcq04218  Cellular senescence
hcq04310  Wnt signaling pathway
hcq04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109522291
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109522291
   04115 p53 signaling pathway
    109522291
   04218 Cellular senescence
    109522291
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109522291
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 109522291
NCBI-ProteinID: XP_019736268
LinkDB
Position
Unknown
AA seq 310 aa
MSMVDTKSVSPDKYCVPQLVFDYDVAVRAGYDLELVGNLRAVQNLRALEVGTSRRMSSHL
PGIQQNIQALKRKTMIIWMFQVCEEQKCEEEVFPLAVHYLDSYLSRHAVRDSMLQLLGVV
TMLLASKMREMVPLTASKLCIYTDFSISLPEILQFEVSLVSRLDWCLASVLPSDFLEPIL
HTLSFLQAQHLPNVRRHVHSYVALATIELKSFDFLPSTLACACVSTATQRLNLVDSPDSL
LKFLANLLVIDLGSVLLCYSQLQRAVDLILPSSPFQAAVCRSEVSQAPADVDHLLLTSLT
PAESQLETPP
NT seq 933 nt   +upstreamnt  +downstreamnt
atgtctatggtggacaccaaatctgttagcccggataaatattgtgtccctcaactggtg
tttgattatgacgtcgctgtacgggcgggctacgacttggaattagttgggaacctccgt
gctgttcagaacctgagagccctggaggtgggcaccagtcgccgaatgtcttctcacttg
cctggaatccagcagaacatccaggcgctcaagaggaagacaatgatcatctggatgttc
caggtatgtgaggagcagaaatgtgaggaagaggtgttccctcttgcggtccactacctg
gactcttacctgagccgccatgctgtgcgagactctatgctgcagcttttaggggtcgtc
accatgttgctggcctccaagatgagagagatggttcctctgacagccagcaagctctgc
atctacaccgacttctctatttcattgccagaaatcctgcagttcgaggtgtcactggtg
tccaggttagactggtgtctggcctctgtgctcccctctgacttcctggagccaattctt
cacacgctctcctttctccaagcccagcatcttcccaacgtgcgacgacatgttcactcc
tacgtcgcactggcaaccatcgagttgaagtcttttgactttttgccctccacccttgct
tgtgcctgtgtgagcaccgcaacacagaggctcaacttggtggactcccctgactcactg
ctcaagtttctggctaatctcttggtcattgatctgggctccgtcctcctctgctacagt
cagctgcagagagcagtggatctcatcctgccttcttcccctttccaagccgctgtttgc
agatcagaggtcagtcaggctcccgctgatgttgaccatcttttattgacgtcattgacg
cccgctgaaagccagctggaaaccccgccctga

KEGG   Hippocampus comes (tiger tail seahorse): 109526797
Entry
109526797         CDS       T04969                                 

Gene name
ccnd2
Definition
(RefSeq) G1/S-specific cyclin-D2 isoform X1
  KO
K10151  G1/S-specific cyclin-D2
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04068  FoxO signaling pathway
hcq04110  Cell cycle
hcq04115  p53 signaling pathway
hcq04218  Cellular senescence
hcq04310  Wnt signaling pathway
hcq04340  Hedgehog signaling pathway
hcq04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109526797 (ccnd2)
   04340 Hedgehog signaling pathway
    109526797 (ccnd2)
   04068 FoxO signaling pathway
    109526797 (ccnd2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109526797 (ccnd2)
   04115 p53 signaling pathway
    109526797 (ccnd2)
   04218 Cellular senescence
    109526797 (ccnd2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109526797 (ccnd2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Herp-Cyclin SbcD_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 109526797
NCBI-ProteinID: XP_019743870
UniProt: A0A3Q2XZ93
LinkDB
Position
Unknown
AA seq 297 aa
MELLCLEMDTNIRARPDPNLLCDDRVLQSLLTIEERFLPQYSYFKGVQRDIQPFMRRMVA
TWMLEVCEEQKCEEEVFPLAMNYLDRFLAVVPTKKCNLQLLGAVCMFLASKLKETRPLTA
EKLCIYTDNSIRPQELLEWELVVLGKLKWNLAAVTPNDFIEHIVRRLPLPEDKLTLIRKH
VQTFIALCATDFRFAMYPPSMIATGSVGAAICGLQLDSVNQSQWGDSLTDLLAKITNTEV
DVLKECQEQIERVLESSLREGRKQQQQQQQSQRGTSSKGLEELDQSSTPTDVRDINL
NT seq 894 nt   +upstreamnt  +downstreamnt
atggagctgctctgcctcgaaatggacacgaatatacgggctcgtcccgatccgaacctc
ctttgtgatgaccgagtcctccagagcttgttgaccatagaggagaggtttctacctcaa
tattcgtattttaaaggggtgcagagagacattcagccctttatgaggaggatggtcgcc
acttggatgttggaggtttgtgaggagcagaagtgcgaggaagaagtttttcccctggcc
atgaactacttagacagatttctagcagttgtccccaccaaaaagtgtaacctgcagctg
ctgggagcagtttgcatgtttcttgcatccaaattgaaagagactcgtccattaactgca
gagaagctttgcatctacacagataactccatcagaccacaagagctgctggaatgggaa
ctggtggtgttggggaagttgaagtggaacctggcagcagtgacgccaaacgactttatc
gagcacatagtgaggaggctgccgctgcctgaggataaactgactcttatacgcaaacat
gtccagacgttcatcgccttgtgtgccacagacttcagattcgccatgtaccctccatcc
atgattgccacaggaagtgtgggggcagcaatctgcggcttacagctggactcagtgaac
caatcccagtggggcgacagtctgacagaccttctggccaaaatcacaaatacagaagtg
gatgtcctcaaagagtgccaggagcagatcgagcgtgtgttagagagcagcctgcgcgag
ggccggaagcagcagcaacagcagcagcagagtcagagaggcacgagcagtaaaggcctg
gaagagctggatcagtcctccaccccgacagacgtccgtgacatcaacttgtga

KEGG   Hippocampus comes (tiger tail seahorse): 109527710
Entry
109527710         CDS       T04969                                 

Definition
(RefSeq) G1/S-specific cyclin-D2-like
  KO
K10151  G1/S-specific cyclin-D2
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04068  FoxO signaling pathway
hcq04110  Cell cycle
hcq04115  p53 signaling pathway
hcq04218  Cellular senescence
hcq04310  Wnt signaling pathway
hcq04340  Hedgehog signaling pathway
hcq04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109527710
   04340 Hedgehog signaling pathway
    109527710
   04068 FoxO signaling pathway
    109527710
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109527710
   04115 p53 signaling pathway
    109527710
   04218 Cellular senescence
    109527710
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109527710
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 109527710
NCBI-ProteinID: XP_019745324
LinkDB
Position
Unknown
AA seq 305 aa
MQTDDRGVSLWCEETEEDYQSQSTKRASESRGLGVPLRAAWDPSVSGRRVIQRLLHVEER
YAPTQLYVTLIQQEPERREELAKWTLEVCYDCGCDEAVFPLSVSLMDRFLSATLSTPASP
YCLAAACMLIASKLSECENITSDALCAAAEYNFLPANLREMERVVLATLRWDTAAVTPQD
FLPHFLASLEERSGQDSATLRRHSDTLAAMCACDSRFLGAPPSLVAAASLNCAMRGLGHR
GRSRLHLLSLTLAELCQADLVVLQYYSEMIERTLRQRLSSGPADKGDELEDERAGTPTDM
REIDF
NT seq 918 nt   +upstreamnt  +downstreamnt
atgcagacggatgacagaggtgtgtcattgtggtgcgaggaaacagaagaggactaccaa
agtcagagcaccaaaagagcatcggagtcgagaggcctcggggttccactgcgagccgcc
tgggacccgtctgtgtcggggaggcgtgtgatccagagactgcttcacgtggaggaacga
tacgcgcccacgcagctctacgttactctgattcagcaggagcccgaaagacgcgaggag
ctggccaagtggacactggaggtgtgctacgattgcggctgcgacgaggccgtgttccct
ctatccgtttccctgatggacaggttcctgtcggctacgttgtccacgcccgcctcgccg
tattgcctggcggcagcctgcatgctcattgcctcaaagctgagcgagtgtgagaacatc
acctcggatgccctctgcgccgccgccgagtacaacttcctgcccgccaatcttcgggag
atggagcgggtggtcctggccaccctgcgctgggacacggcggccgtgacgccccaggac
ttcctgccgcacttcctggcatcacttgaggagagaagcgggcaggacagcgccaccttg
aggcgacacagcgacacgctggcagccatgtgcgcgtgcgactcgcgcttcctcggggcg
ccgccctccctggtggctgccgcttctctcaactgcgctatgcggggcctgggacacagg
gggcgctctcggctccacctgctcagcttgacgctggccgagctgtgccaggctgacctg
gtggtgctgcagtactacagtgagatgatcgagcgcaccctccgccagcgcctcagcagc
gggccggcagacaaaggcgacgagctcgaggacgaaagagccggcacacccaccgacatg
agagaaatcgatttttaa

KEGG   Hippocampus comes (tiger tail seahorse): 109530113
Entry
109530113         CDS       T04969                                 

Definition
(RefSeq) G1/S-specific cyclin-D2-like
  KO
K10151  G1/S-specific cyclin-D2
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04068  FoxO signaling pathway
hcq04110  Cell cycle
hcq04115  p53 signaling pathway
hcq04218  Cellular senescence
hcq04310  Wnt signaling pathway
hcq04340  Hedgehog signaling pathway
hcq04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109530113
   04340 Hedgehog signaling pathway
    109530113
   04068 FoxO signaling pathway
    109530113
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109530113
   04115 p53 signaling pathway
    109530113
   04218 Cellular senescence
    109530113
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109530113
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Herp-Cyclin
Other DBs
NCBI-GeneID: 109530113
NCBI-ProteinID: XP_019749246
UniProt: A0A3Q2ZJB8
LinkDB
Position
Unknown
AA seq 292 aa
MELYCMESVAEVKAPVDPNILHDDRVLQTLLTVEDRFLPQCSYFQRVQKDIKPYMRRIVA
GWMLEVCEAERSEEDIFPLAINYLDRFLAVMPTRKDYLQLLGAVCMFLASKLKDSRPISA
EKLCMYTDNSISPLELLNWEVVVLGKLRWNMAAVIPNDFLEHIMRRLPLPEDKVPMIRKH
TQTFIALCATDDGLAMNPPSMIASGSMGAAVCGLQLDHKDKRLTRDNLTDLLAKITNAEV
ECLRACQEQIERVLAASLQQDNRTGGANAGNKSQEQQQDQSSTPTDVRDVNL
NT seq 879 nt   +upstreamnt  +downstreamnt
atggagctttactgcatggagtcggtggcggaggtgaaagccccggtggacccgaacatc
ctccacgatgaccgggtcttgcaaaccctgctgaccgtggaggaccgcttcttaccgcag
tgctcctacttccagcgggtccagaaggatattaagccgtacatgaggcgaatcgtcgcg
ggttggatgctcgaggtgtgtgaggccgagaggagtgaagaggacatcttcccactggcc
atcaattatttggacagattccttgccgtgatgcccaccaggaaggattatctgcagctg
ctgggtgccgtgtgcatgttcttggcctccaaactgaaggacagcaggcccatctccgcc
gagaagctgtgcatgtacacggacaactccatctcaccactggagctgctgaactgggag
gtggtggtgctgggcaagttgaggtggaacatggcggccgtcatccccaacgactttttg
gagcacatcatgcgccggctgcccctccccgaagacaaggtgccgatgatccgcaagcac
acgcagaccttcatcgccttgtgcgcgacagatgacggtcttgccatgaaccccccctcc
atgatcgccagcggcagcatgggggccgccgtctgtggcctgcagctggaccacaaggac
aagaggctgacgagagacaacctgacggacctgctggccaagatcaccaacgcagaagta
gaatgtttgcgagcgtgccaggagcagatcgagcgcgtcctggccgccagcctgcaacag
gacaaccgaacgggcggcgcaaacgccggcaacaagtcgcaggagcagcagcaggaccag
tccagcacccccaccgacgtgcgcgacgtcaacttatga

DBGET integrated database retrieval system