KEGG   Hippocampus comes (tiger tail seahorse): 109525384
Entry
109525384         CDS       T04969                                 

Gene name
zmat3
Definition
(RefSeq) zinc finger matrin-type protein 3
  KO
K10137  zinc finger, matrin type 3
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109525384 (zmat3)
SSDB
Motif
Pfam: zf-C2H2_jaz zf-met TUTase zf-C2H2_2 zf-U1 CCDC84
Other DBs
NCBI-GeneID: 109525384
NCBI-ProteinID: XP_019741378
LinkDB
Position
Unknown
AA seq 452 aa
MLKPALSLFSHAQQPFQHMDSLHQLGPPPMVPTQPLGPPPVIPTAAIGAPNVVGAQTLVP
PPITAAHTMRPPHIAPVHSLGPPPLVPAQPLGPPPLTHTLGPPSLDPLQAMVPPSLDLTQ
PLGPPPLNHAHALVPPVPTGVNRFPLPPSPLSSPLIPSPEVSQLPLRPGPPLISSPVSAL
LPGPLPGQAAPASEQPKEEGSPLVREEQGDAPALEELCKPLYCKLCNVTVNSAQQAQAHY
QGKNHSKKLRNFLAGSQQPPAIRIPEVLEAAGQTNLISGSSDTDTTRQTLYKGPTRVILA
TENDYCKLCDASFSSLLVAQAHYQGKNHAKKLRLAEAQQNTSNVIFHFRDCIREVSPKRN
WKDGNEYRLVKNRRSPQLPTSMQGPYYNPRPRQRIPRDLAMCVTPSGQFYCSMCNCGAEQ
ETDFRQHLESKQHKAKVSEWRYRNEMENLGYS
NT seq 1359 nt   +upstreamnt  +downstreamnt
atgctgaagcctgctctcagtctcttcagccacgcacagcagccttttcaacacatggac
tccctgcaccagctgggacctccaccgatggtgcctacgcagcctctcggccccccgccg
gtcatccctactgcagcaatcggagcgccaaatgtggttggcgcccagactctggtgccc
cctcctatcactgctgctcacacaatgaggcctccccacattgcccccgtccatagttta
ggcccgccgccattagttccagctcagcctctcgggccgcctcctttgacacacaccttg
ggaccgccatcactggaccccttacaagcaatggtgcctccttctttagacctcacacaa
ccgctggggcctccccctttgaaccacgcacatgcgttggttccccccgtgcctaccgga
gtcaacagattccccctgccacccagccccttgtcctccccgctaatcccgagcccagaa
gtctcacaactgcccctaagacccggacctccactcatctcatccccagtgtccgctctt
ctaccgggtcctcttccgggtcaggcagccccagccagcgagcagcccaaggaagagggc
tctcctctggttagggaagagcagggggacgcgcccgctctggaagaactttgcaaacct
ttgtactgtaaactctgcaatgttaccgtcaactcagctcagcaagcacaggctcactac
caggggaagaaccacagtaaaaagttgcggaattttctagctggcagtcagcagccacca
gccatcaggatccccgaagtcctcgaggcagccggacagacaaacctcatctcaggatcc
agtgacactgatactacgagacagacgttgtacaaggggcccacccgggtcattttggcc
acagagaatgactattgtaagctgtgcgatgcctccttcagctccctcttagttgcacag
gcgcactaccagggcaagaaccacgcaaagaaactccgcctggccgaggcccagcagaac
accagtaacgtgatcttccatttcagggactgtattcgcgaagtaagcccaaaaaggaac
tggaaggatggcaatgagtacagactggtgaaaaatcgccgtagcccacagcttcctacc
tccatgcaagggccgtactacaaccccagaccgaggcagcggatcccccgagatttagcc
atgtgcgtgacccccagcggacagttctactgctccatgtgcaactgcggcgctgaacaa
gaaacggacttccgacagcatctggaaagcaagcaacacaaagctaaagtgtccgagtgg
aggtaccgcaacgagatggagaacttgggctacagctaa

DBGET integrated database retrieval system