KEGG   Halomonas campaniensis: FF32_11860Help
Entry
FF32_11860        CDS       T03198                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
hcs  Halomonas campaniensis
Brite
KEGG Orthology (KO) [BR:hcs00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    FF32_11860
Enzymes [BR:hcs01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     FF32_11860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like Glutaredoxin K_oxygenase DAO Thi4 FAD_oxidored FMO-like Methyltrn_RNA_4 DUF2190 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AIA75509
UniProt: A0A060B8G2
LinkDB All DBs
Position
complement(2599501..2601057)
Genome map
AA seq 518 aa AA seqDB search
MLDANLKNQLKAYLEKVTQPFEIVASLDDGAKSRELLGLLEDISGLCDKITLQTDGQDNR
TPSFAINRPGEETGVVFAGIPMGHEFTSLVLALLQVGGHPPKTSEELLNQIKALDGEMLF
ETYYSLSCQNCPDVVQALNLMAIFNPNIRHVAIDGALFQDEVEAREIMSVPSIYLNGKPF
DQGRMTLEQILDKVDTGAAEREAKKLSEKAAFDTLVIGGGPAGASAAIYSARKGINTGVA
AERFGGQVADTMGIENFISVSHTEGPKLVSALEEHVKEYDVDVMNLQRATSFKAAENEGD
LHEITFESGAKLKSKTLVLATGARWREMNVPGEQQYRNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVGHVTLVEFMGEMRADAVLQKKLKSLPNVDIILNAETTEVTGDG
SRVNGLAYKDRNTDELKTIALEGIFVQIGLVPNTEWLKGSPIEMTPRGEIIVDAHGMTSV
SGVFAAGDVTTVPYKQIIIAMGEGAKASLGAFDYLIRH
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgccaatttaaaaaatcagttgaaagcttatttagaaaaagtgactcaaccg
ttcgagatcgttgcgtccctcgatgacggtgccaagtcacgtgaattgctaggtttgctc
gaagacatcagcggcctatgcgacaagattacactacaaactgacggtcaagataatcgc
acgccgtcatttgccattaaccgccccggcgaagaaaccggcgtggtatttgctggcatc
ccgatggggcacgagttcacctcgctggtgctggcactgctacaagtgggtgggcatccc
ccaaaaacgtccgaagaactgctaaatcaaatcaaagcgcttgacggcgaaatgctgttc
gagacgtactactcgctctcctgtcaaaactgcccagatgttgttcaagcgctcaatttg
atggcgattttcaatccaaatattcgccacgtagccattgatggcgcactgttccaagat
gaagtcgaagctcgggaaatcatgtcggttcccagcatctatttaaacggtaaaccgttt
gaccagggacgtatgaccttagagcagattctagacaaggttgatacaggtgctgccgaa
cgagaagcgaaaaaacttagcgaaaaagccgcctttgatacgctggtaattggtggtggc
cctgcaggtgcctcagcggcgatctactctgctcgtaaagggatcaacacaggcgttgct
gctgagcgtttcggtggacaggtggcagacaccatgggcattgaaaacttcatctccgtc
agccataccgaaggccctaaactggttagcgctctggaagagcatgttaaagagtatgac
gttgacgttatgaaccttcagcgcgccacgtcgtttaaagcagctgaaaacgaaggtgat
ttgcacgaaataaccttcgagtcgggcgctaagctgaagagtaaaaccctcgtcctggca
accggtgcgcgttggcgcgagatgaatgtgcctggtgaacaacagtaccgcaacaaaggc
gttgcttactgcccccactgcgatggcccgctatttaaaggcaagcgcgtagcagtgatt
ggcggcggcaactctggcgttgaggccgctatcgatctggccggtattgtaggccacgtc
accctagtcgagtttatgggtgagatgcgtgcagacgccgtactacagaaaaagcttaag
agcctgcctaacgtcgacattattttaaacgctgaaaccacggaagtgacaggcgacgga
agccgggttaacggcttagcctataaagatcgcaataccgatgagctgaaaaccatcgca
ctagaaggcatctttgttcaaattggcttagtgcctaataccgaatggctgaaaggctca
ccgattgaaatgacgccacgcggtgaaatcattgtcgatgcccatggcatgacgtcggtt
tcaggcgtatttgccgcaggcgacgtgactaccgtgccatacaagcaaattattatcgcc
atgggtgaaggtgcaaaagcatcacttggtgcgtttgactatttgattcgccactaa

DBGET integrated database retrieval system