KEGG   Hyphomicrobium denitrificans 1NES1: HYPDE_37443Help
Entry
HYPDE_37443       CDS       T02646                                 

Definition
(GenBank) Gst15 protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hdt  Hyphomicrobium denitrificans 1NES1
Pathway
hdt00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:hdt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    HYPDE_37443
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hdt02000]
    HYPDE_37443
Enzymes [BR:hdt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     HYPDE_37443
Transporters [BR:hdt02000]
 Other Transporters
  Pores ion channels [TC:1]
   HYPDE_37443
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: AGK59160
UniProt: N0BGA3
LinkDB All DBs
Position
2955049..2955678
Genome map
AA seq 209 aa AA seqDB search
MTEKTLTHYHAPNTRSLTIRWLFEELGAPHELKVLNLKKGEHKTPEYLTINPMGKVPTIV
HGSTPVTEVGAIAIYLADLFPEAGLAPAIGDPERGTYLRWIIFNQSAVEPAICDFALKRE
PGQPSMMPYGTYDETMKAFAGALAKGPYILGDSFSAADVVVGSGVRWMLMFKLLPEQPEF
TNYADRVTHRPAFVRAVTKDAELAKVLAT
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgactgagaaaacgctaacgcattatcatgcgccgaatacacgctcgctgacgattcgc
tggctgttcgaagagctcggcgcgccgcacgagctgaaagttctcaacctgaagaagggc
gagcacaaaacgcccgaatatctgaccatcaatccgatgggcaaggttccgacgattgtg
catggcagtacgcccgtcaccgaagtcggtgcgatcgcgatctatctggccgatctcttt
ccggaagctggccttgctccggcaatcggcgatcccgagcgcggaacgtatttgcgatgg
atcatcttcaatcaaagcgcggttgagcccgcgatatgcgatttcgcattgaagcgagaa
ccgggacaaccgtcgatgatgccttatggcacgtatgacgaaacgatgaaggcctttgcc
ggcgcactcgccaagggcccttacattctaggcgatagtttttccgcggccgacgtcgtc
gttggatcgggcgtgcgctggatgctgatgttcaagctgctgcccgagcagccggaattt
acgaactatgccgatcgcgtgacgcaccggccggcgttcgtccgtgcggtgacgaaagat
gctgagcttgcgaaagtgctcgcgacctag

DBGET integrated database retrieval system