Halomonas elongata: HELO_2874 Help Entry HELO_2874         CDS       T01311                                  Symbol groES Name (GenBank) molecular chaperone GroES   KO K04078   chaperonin GroES Organism hel  Halomonas elongata Brite KEGG Orthology (KO) [BR:hel00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:hel03110]     HELO_2874 (groES)    03029 Mitochondrial biogenesis [BR:hel03029]     HELO_2874 (groES) Chaperones and folding catalysts [BR:hel03110]  Heat shock proteins   HSP10    HELO_2874 (groES) Mitochondrial biogenesis [BR:hel03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     HELO_2874 (groES) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Rad9_Rad53_bind Motif Other DBs NCBI-ProteinID:  CBV42758 UniProt:  E1V3S9 LinkDB All DBs Position 2188649..2188942 Genome browser AA seq 97 aa AA seqDB search MNIRPLHDRVVIRRVEEEQKTAGGIVLPGSAQEKPTRGEVLAVGNGRILESGDVRPLDVK VGDTVIFKEGFGVEKQKVDGEEVLIMSESDILAVVEG NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgaacatccgtcccttgcacgatcgcgtcgtcattcgtcgcgttgaagaagagcaaaag accgcaggcggcatcgtgctcccgggcagtgcccaggaaaagccgacacggggcgaagtg ctcgccgtcggtaacggccggattctggaaagcggcgatgtccgtccgctcgacgtcaag gtcggcgacaccgtgatcttcaaggaaggcttcggcgtcgagaagcagaaagtcgacggc gaagaagtactgatcatgagcgaatccgacatcctggccgtcgtcgaaggctga

DBGET integrated database retrieval system