KEGG   Heterocephalus glaber (naked mole rat): 101698854Help
Entry
101698854         CDS       T02812                                 

Gene name
Ptgs1
Definition
(RefSeq) prostaglandin-endoperoxide synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00590  Arachidonic acid metabolism
hgl01100  Metabolic pathways
hgl04611  Platelet activation
hgl04726  Serotonergic synapse
hgl04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    101698854 (Ptgs1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101698854 (Ptgs1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    101698854 (Ptgs1)
  09156 Nervous system
   04726 Serotonergic synapse
    101698854 (Ptgs1)
Enzymes [BR:hgl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     101698854 (Ptgs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF hEGF EGF_2
Motif
Other DBs
NCBI-GeneID: 101698854
NCBI-ProteinID: XP_004849484
UniProt: A0A0N8EUB9
LinkDB All DBs
Position
Un
AA seq 600 aa AA seqDB search
MSRESLSLRFPLLLLLLPPPAVLPADLGAPTPANPCCYFPCQNQGVCVRFGRDHYQCDCT
RTGYSGPNCTVPELWTWLRNSLRPSPAFFHFLLTHGRLFWEFVNATFIRDMLMRLVLTVR
SRLIPSPPTYNLAHDYISWESFSNVSYYTRILPSVPKDCPKPMGTKGKKQLPDAELLGHH
FLLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLER
QYHLRLFKDGKLKYQVLDGEVYPPSVEEAPVLMHYPRGIPLESQMAVGQEVFGLLPGLML
YATLWLREHNRVCDLLKAEHPTWEDEQLFQTTRLILIGETIKIVIEEYVQQLSGYFLQLK
FDPELLFRAQFQYHNRIAVEFNHLYHWHPLMPDSFKVGSQKYSYEQFLFNTSMLVDYGVE
ALVDAFSRQSAGRIGGGRNIDHHVLHVAVEVIKEAREMRLQPFNEYRKRFGMKPYTSFQE
LTGDKEMAAELEELYGDIDALEFYPGLLLEKCLPNAIFGESMIEFGAPFSLKGLLGNPIC
SPEYWKPSTFGGEMGFNIVNTATLKKLVCLNTKTCPYVSFRVPSSSQDDGSAVERPSTEL
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgagcagggagagtctctcgctccggttcccgctgctcctgctcctgttgccgccacct
gcggtcctgcccgcggaccttggggcgcccacacccgcgaacccctgttgctactttcca
tgtcagaaccagggtgtctgtgtccgctttggccgtgaccactaccagtgtgactgtacc
cgcacgggctactccggccccaactgcaccgtccctgagctctggacctggctccggaat
tccttgcggcccagccctgctttctttcacttcctactcacacatggacgtttgttttgg
gagtttgtcaatgccaccttcatccgagacatgctcatgcgcctggtgctcacagtgcgg
tccagactcatccccagcccccccacctacaatttagcgcatgactacatcagctgggaa
tctttttccaatgtcagctattatactcgaattttgccctctgtgcccaaagactgcccc
aaacccatgggcactaaagggaagaagcaactgccagatgcagagctcctgggccatcac
ttcctgctcaggaggaagttcatccctgatcctcagggcacaaacctcatgtttgccttc
tttgcacaacacttcacccaccagttcttcaagacttctggcaagatgggtcctggcttc
accaaggccttgggccacggggtagaccttggccacatttatggagataatctagaacgc
cagtatcacctgcggctctttaaggatgggaaactcaagtatcaggtgctggatggggag
gtgtacccgccatcagtggaagaggcacctgtgttgatgcactacccacggggcatcccg
cttgaaagccagatggccgtgggccaagaggtgtttgggctgctgccggggctcatgctc
tatgccacactctggctgcgtgagcacaaccgtgtgtgcgacctgctgaaggcagagcac
cccacctgggaagacgaacagctcttccagactacccgcctcatcctcataggagagacc
atcaagattgtcattgaggagtacgtgcagcagctgagtggctacttcctgcagctcaag
tttgaccctgagctgctgttccgtgcccagttccagtaccacaaccgcattgccgtggag
ttcaaccacctctatcactggcatccactcatgcctgactccttcaaagtgggctcccag
aagtacagctatgagcagttcttattcaacacctccatgctagtggactacggagtcgag
gccctggtggatgccttttctcgccagagcgctggtcggattggtgggggaaggaacata
gaccaccatgttctgcacgtggctgtggaggtcatcaaggaggctcgagagatgcgactg
cagccattcaatgagtaccgcaagagatttggcatgaagccctacacctctttccaggag
ctcacaggggacaaggagatggcagctgagttggaggagttatatggagacattgatgcc
ttagagttctacccagggttgcttcttgaaaaatgcctaccaaacgccatctttggggag
agtatgatcgagtttggggctcccttttccctcaagggtctcctggggaatcccatctgt
tctccagagtactggaagccaagcacatttggtggtgagatgggcttcaatattgtcaac
acggccacactgaagaagctggtctgcctcaacaccaagacctgtccttatgtttccttc
cgcgtgcccagctccagtcaggatgatgggtccgctgtggagcgaccatccacagaactc
tga

DBGET integrated database retrieval system