KEGG   Heterocephalus glaber (naked mole rat): 101701338
Entry
101701338         CDS       T02812                                 

Gene name
Irf9
Definition
(RefSeq) interferon regulatory factor 9
  KO
K04693  interferon regulatory factor 9
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04217  Necroptosis
hgl04380  Osteoclast differentiation
hgl04621  NOD-like receptor signaling pathway
hgl04625  C-type lectin receptor signaling pathway
hgl04630  JAK-STAT signaling pathway
hgl05160  Hepatitis C
hgl05162  Measles
hgl05164  Influenza A
hgl05165  Human papillomavirus infection
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05168  Herpes simplex virus 1 infection
hgl05169  Epstein-Barr virus infection
hgl05171  Coronavirus disease - COVID-19
hgl05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101701338 (Irf9)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101701338 (Irf9)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101701338 (Irf9)
   04625 C-type lectin receptor signaling pathway
    101701338 (Irf9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101701338 (Irf9)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101701338 (Irf9)
  09172 Infectious disease: viral
   05160 Hepatitis C
    101701338 (Irf9)
   05171 Coronavirus disease - COVID-19
    101701338 (Irf9)
   05164 Influenza A
    101701338 (Irf9)
   05162 Measles
    101701338 (Irf9)
   05168 Herpes simplex virus 1 infection
    101701338 (Irf9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101701338 (Irf9)
   05169 Epstein-Barr virus infection
    101701338 (Irf9)
   05165 Human papillomavirus infection
    101701338 (Irf9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hgl03000]
    101701338 (Irf9)
Transcription factors [BR:hgl03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    101701338 (Irf9)
SSDB
Motif
Pfam: IRF IRF-3
Other DBs
NCBI-GeneID: 101701338
NCBI-ProteinID: XP_004864180
LinkDB
Position
Un
AA seq 387 aa
MASGRARCTRKLRSWVVEQVESGQFPGVCWDDEPAKTMFRIPWKHAGKQDFREDQDALFF
KAWAVFKGKYKEGDTRGPAVWKTRLRCALNKSPEFKEVPERGRMDVAEPYKVYRLLPPGT
LPAQPGTQKSSKRHRSSVSPQREEEEETVKSCTLSLSCLQDPFSNEEARAAGRAGHLDSG
SCSSSPDPQEGADSTEAQEDQTEHLLPQNPDYSLLLTFIYSGRVVDQRQVDSLDCRLVAE
ASSSESTITQVIFPKPDPGEPSQRLLSQLEKGILVASNSRGVFVQRLCPIPISWNAPQAP
PGPGPHLLPSNKCMELFKTACFCRDFDRYSQGLGPPPKSQVTLHFWEESPGPSHTLQNPI
TVQMEQAFARHLLKETPEEQRAPLFLM
NT seq 1164 nt   +upstreamnt  +downstreamnt
atggcatcaggcagggctcgctgcacccggaagctccgaagctgggtggtggaacaagtg
gagagtgggcagttcccaggggtgtgctgggatgatgagccagctaagaccatgttccgg
attccctggaagcatgcaggcaagcaggacttccgggaggaccaggatgccctcttcttc
aaggcctgggcagtatttaagggaaagtacaaggagggggacacacgaggccctgctgtc
tggaagactcgtcttcgctgtgccctcaacaagagtccagaatttaaggaggttcctgag
agaggccgtatggatgttgctgagccctacaaggtatatcggctgctgcctccaggaacc
ctgcctgcccagccagggacccagaaatcatcaaagcgacaccgaagttctgtgtctcca
cagagggaggaggaggaagagaccgtgaagagctgcacactcagtctatcctgcctccag
gaccccttcagtaatgaggaggcgagagccgctggcagagcaggccacctagacagtggg
agctgcagcagcagccctgacccacaggaaggtgcagacagcactgaggctcaggaggat
cagacggagcatctgctcccccagaacccagactactcgctgctgctcaccttcatctac
agtgggcgtgtggtggaccagcgccaggtggacagcctggactgtcgccttgtggccgag
gcctccagctctgagagcaccataacacaggtgatatttcccaagcctgacccaggagag
cccagccagcgcctgctgagccagctcgaaaaaggcatcctggtagccagcaactcccga
ggcgtctttgtgcagcgcctttgtcccatccccatctcctggaatgcaccccaggcccca
cctggcccgggcccacatctgctgcccagcaacaagtgcatggagctcttcaaaactgcc
tgcttctgcagagactttgacaggtactcccaaggcctgggccccccacccaagtcccag
gtaacactgcatttctgggaagagagccctggccccagccatactctacagaatcctatc
acggtgcaaatggagcaagcctttgcccggcatttactgaaggagacgccagaggagcag
agagcccctctgttcctgatgtag

DBGET integrated database retrieval system