KEGG   Heterocephalus glaber (naked mole rat): 101713378
Entry
101713378         CDS       T02812                                 

Gene name
Smad3
Definition
(RefSeq) SMAD family member 3
  KO
K23605  mothers against decapentaplegic homolog 3
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04068  FoxO signaling pathway
hgl04110  Cell cycle
hgl04144  Endocytosis
hgl04218  Cellular senescence
hgl04310  Wnt signaling pathway
hgl04350  TGF-beta signaling pathway
hgl04371  Apelin signaling pathway
hgl04390  Hippo signaling pathway
hgl04520  Adherens junction
hgl04550  Signaling pathways regulating pluripotency of stem cells
hgl04659  Th17 cell differentiation
hgl04933  AGE-RAGE signaling pathway in diabetic complications
hgl05161  Hepatitis B
hgl05166  Human T-cell leukemia virus 1 infection
hgl05200  Pathways in cancer
hgl05210  Colorectal cancer
hgl05212  Pancreatic cancer
hgl05220  Chronic myeloid leukemia
hgl05225  Hepatocellular carcinoma
hgl05226  Gastric cancer
hgl05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101713378 (Smad3)
   04350 TGF-beta signaling pathway
    101713378 (Smad3)
   04390 Hippo signaling pathway
    101713378 (Smad3)
   04371 Apelin signaling pathway
    101713378 (Smad3)
   04068 FoxO signaling pathway
    101713378 (Smad3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101713378 (Smad3)
  09143 Cell growth and death
   04110 Cell cycle
    101713378 (Smad3)
   04218 Cellular senescence
    101713378 (Smad3)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101713378 (Smad3)
   04550 Signaling pathways regulating pluripotency of stem cells
    101713378 (Smad3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101713378 (Smad3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101713378 (Smad3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101713378 (Smad3)
   05212 Pancreatic cancer
    101713378 (Smad3)
   05225 Hepatocellular carcinoma
    101713378 (Smad3)
   05226 Gastric cancer
    101713378 (Smad3)
   05220 Chronic myeloid leukemia
    101713378 (Smad3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101713378 (Smad3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101713378 (Smad3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101713378 (Smad3)
   05161 Hepatitis B
    101713378 (Smad3)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 101713378
NCBI-ProteinID: XP_004855654
UniProt: A0A0N8ETI0
LinkDB
Position
Un
AA seq 425 aa
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQSA
STKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEV
CVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLEDYTHSIPENTNFPAGIEPQSNIPETP
PPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYEL
NQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIG
GEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGF
EAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIR
CSSVS
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgtcgtccatcctgcccttcacccccccgatcgtgaagcgcctgctgggctggaagaag
ggcgagcagaacgggcaggaggagaagtggtgcgagaaggcggtcaagagcctggtgaag
aagctgaagaagacggggcagctggacgagctggagaaggcgatcaccacgcagagcgcc
agcaccaagtgcatcaccatccccaggtccctggatggtcgcctgcaggtgtcccatcgg
aaggggctcccccatgtcatctactgccgcctgtggcgatggccggacctgcacagccac
cacgagctgcgggccatggagctgtgtgagttcgccttcaacatgaagaaggacgaggtg
tgcgtgaacccctaccactaccagagggtggagacgccagttctacctcctgtgctggtg
ccgcgccacacagagatcccagccgagttccccccgctggaggactacacccattccatc
cccgagaacaccaacttccccgccggcatcgagccccagagcaatattccagagacccca
cccccgggctacctgagcgaagatggagaaaccagtgatcatcagatgaaccacagcatg
gatgcaggttctccgaacctctccccaaatccgatgtccccggcacacaataacttggac
ctgcagcctgtcacctactgcgagccagccttctggtgttccatctcctactatgagctg
aaccagcgcgttggggagactttccatgcctcacagccgtccatgaccgtagatggcttc
actgacccctccaactccgagcgcttctgcctaggcctgctgtccaacgtgaataggaac
gcagcggtggagctgacccggagacacattgggagaggtgtgcggctctactacatcgga
ggggaggtattcgcggagtgcctcagcgacagcgctattttcgtccagtctcctaactgt
aaccagcgctacggctggcaccctgccaccgtctgcaagatccccccaggatgtaacctg
aagatcttcaacaaccaggagttcgccgcgctgctggctcagtctgtgaaccagggcttc
gaggccgtctatcagctgacgcgcatgtgtaccatccgcatgagctttgtcaaaggctgg
ggagccgagtataggagacagacagtgaccagcactccctgctggattgagctgcacctg
aatgggcctttgcaatggctggacaaggtcctcacgcagatgggctcccccagcatccgc
tgttccagtgtgtcttag

KEGG   Heterocephalus glaber (naked mole rat): 101714203
Entry
101714203         CDS       T02812                                 

Gene name
Smad2
Definition
(RefSeq) SMAD family member 2
  KO
K04500  mothers against decapentaplegic homolog 2
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04110  Cell cycle
hgl04144  Endocytosis
hgl04218  Cellular senescence
hgl04350  TGF-beta signaling pathway
hgl04371  Apelin signaling pathway
hgl04390  Hippo signaling pathway
hgl04550  Signaling pathways regulating pluripotency of stem cells
hgl04659  Th17 cell differentiation
hgl04926  Relaxin signaling pathway
hgl04933  AGE-RAGE signaling pathway in diabetic complications
hgl05142  Chagas disease
hgl05166  Human T-cell leukemia virus 1 infection
hgl05200  Pathways in cancer
hgl05205  Proteoglycans in cancer
hgl05210  Colorectal cancer
hgl05212  Pancreatic cancer
hgl05225  Hepatocellular carcinoma
hgl05226  Gastric cancer
hgl05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    101714203 (Smad2)
   04390 Hippo signaling pathway
    101714203 (Smad2)
   04371 Apelin signaling pathway
    101714203 (Smad2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101714203 (Smad2)
  09143 Cell growth and death
   04110 Cell cycle
    101714203 (Smad2)
   04218 Cellular senescence
    101714203 (Smad2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101714203 (Smad2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101714203 (Smad2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    101714203 (Smad2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101714203 (Smad2)
   05205 Proteoglycans in cancer
    101714203 (Smad2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101714203 (Smad2)
   05212 Pancreatic cancer
    101714203 (Smad2)
   05225 Hepatocellular carcinoma
    101714203 (Smad2)
   05226 Gastric cancer
    101714203 (Smad2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101714203 (Smad2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101714203 (Smad2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101714203 (Smad2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    101714203 (Smad2)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 101714203
NCBI-ProteinID: XP_004855167
UniProt: A0A0P6JBC5
LinkDB
Position
Un
AA seq 467 aa
MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDE
LEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLV
PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQS
MDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVD
GFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSP
NCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVK
GWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgtcgtccatcttgccattcactccaccagtggtgaagagactcctaggatggaagaaa
tcagctggtgggtctggaggagcaggcggaggagagcagaatggacaggaagaaaagtgg
tgtgagaaagcagtgaaaagtctggtgaagaagctaaagaaaacaggacgattagatgag
cttgagaaagccatcaccactcaaaattgtaatactaaatgtgttactataccaagcact
tgctctgaaatttggggactgagtacaccaaatacgatagatcagtgggatacaacaggc
ctttacagcttctctgaacaaaccaggtctcttgatggtcgtcttcaggtttcacatcga
aaaggattgccacatgttatatattgtcggttatggcgctggcctgatctccacagtcat
catgaactgaaggcaattgaaaattgtgaatatgcttttaatctaaaaaaggatgaagta
tgtgtaaacccttaccactatcagagagttgagacaccagttttgcctccggtattagtg
ccacggcacactgagattctaacagagctaccacctctggatgattatacccactccatt
ccagaaaacactaatttcccagcaggaattgagccacagagtaattatatcccagaaaca
ccaccacctggatatatcagtgaagatggagaaacaagtgatcaacagttaaaccaaagt
atggacacaggctctccagcagaactgtctcctactactctctcccctgttaatcatagc
ttggatttacagccagttacttactctgaacctgcattttggtgttcaatagcatattat
gaattaaatcagagggttggagagaccttccatgcgtcacaaccctcactcactgtagat
ggctttacagatccatcaaattcagagaggttctgcttaggtttactctccaatgttaac
cgaaatgctacagtagaaatgacaagaagacatataggaagaggagtgcgcttatattac
ataggtggggaagtttttgctgagtgcctaagtgatagtgcaatctttgtgcagagcccc
aactgtaatcagagatacggctggcaccctgcaacagtgtgtaaaattccaccaggttgt
aacctgaagatctttaacaaccaggaatttgctgctcttctggctcagtctgttaatcag
ggttttgaagcagtgtatcagctaactagaatgtgcaccataagaatgagttttgtgaaa
gggtggggagcagaataccgaaggcagacagtaacaagtactccttgctggattgaactt
catctgaatggacctctacagtggttggacaaagtattaactcagatgggatccccttca
gtgcgctgctcaagcatgtcataa

DBGET integrated database retrieval system