KEGG   Heterocephalus glaber (naked mole rat): 101717777
Entry
101717777         CDS       T02812                                 

Gene name
Fgf1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04010  MAPK signaling pathway
hgl04014  Ras signaling pathway
hgl04015  Rap1 signaling pathway
hgl04151  PI3K-Akt signaling pathway
hgl04390  Hippo signaling pathway
hgl04810  Regulation of actin cytoskeleton
hgl05200  Pathways in cancer
hgl05218  Melanoma
hgl05224  Breast cancer
hgl05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101717777 (Fgf1)
   04014 Ras signaling pathway
    101717777 (Fgf1)
   04015 Rap1 signaling pathway
    101717777 (Fgf1)
   04390 Hippo signaling pathway
    101717777 (Fgf1)
   04151 PI3K-Akt signaling pathway
    101717777 (Fgf1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101717777 (Fgf1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101717777 (Fgf1)
  09162 Cancer: specific types
   05226 Gastric cancer
    101717777 (Fgf1)
   05218 Melanoma
    101717777 (Fgf1)
   05224 Breast cancer
    101717777 (Fgf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    101717777 (Fgf1)
   00536 Glycosaminoglycan binding proteins [BR:hgl00536]
    101717777 (Fgf1)
Cytokines and growth factors [BR:hgl04052]
 Growth factors
  Growth factors (RTK binding)
   101717777 (Fgf1)
Glycosaminoglycan binding proteins [BR:hgl00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   101717777 (Fgf1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 101717777
NCBI-ProteinID: XP_004854374
LinkDB
Position
Un
AA seq 181 aa
MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGKVDGTRDRSDQHIQLQ
LSAEGVGEVYIKSTETGQYLAMDTDGLLYGSLCASMLMCGPSSSRGSRVIQQQARNACSW
KGWRKTITTPTYPRSMQRRIGLLASRRTEAANVVLGLTMARKQSCSSPCQSPLIREICSG
C
NT seq 546 nt   +upstreamnt  +downstreamnt
atggctgaaggagaaatcacaaccttcacagccctgactgagaagtttaatctgcctcca
gggaattacaagaagcccaaactgctctactgcagcaacgggggccacttcctgaggatc
cttccagacggcaaagtggatgggacaagggacagaagcgaccagcacattcagctgcag
ctcagtgcggaaggcgtgggggaggtgtatataaagagcaccgagaccggccaatacttg
gccatggacaccgacgggcttctgtacggctcactgtgtgcatccatgctaatgtgcgga
ccgagttcctctagagggagcagagtcatccaacagcaagcgaggaatgcttgttcctgg
aaaggctggaggaaaaccattacaacacctacatatccaagaagcatgcagagaagaatt
ggtttgttggcctcaagaagaacggaagctgcaaacgtggtcctcggactcactatggcc
agaaagcaatcttgttcctccccttgccagtctcctctgattagagaaatctgttctggg
tgctga

DBGET integrated database retrieval system