KEGG   Heterocephalus glaber (naked mole rat): 101719404Help
Entry
101719404         CDS       T02812                                 

Gene name
Setd2
Definition
(RefSeq) SET domain containing 2
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    101719404 (Setd2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hgl03036]
    101719404 (Setd2)
Enzymes [BR:hgl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101719404 (Setd2)
Chromosome and associated proteins [BR:hgl03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101719404 (Setd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET WW
Motif
Other DBs
NCBI-GeneID: 101719404
NCBI-ProteinID: XP_012931067
LinkDB All DBs
Position
Un
AA seq 3821 aa AA seqDB search
MKQLPPQQPPPKMGDFYDPEHPTPEEEENEAKIESVQKTGFIKGPMFKGVASSRFLPKGT
KTKVNLEEQGRQKVSFSFSLTKKTLQNRFLTALGNEKQNDTPNSPALSQGDSTPKIKVDI
GDTLATTEESSPPKSRVELGKIHFKKHLLHVTSRPLLATTSAVASPSPPPVQLPAVIPES
TTIDSPPSSPPPPPPPPQATTPSSPAPITEPVASPHTPVTVLTTAPLSLPVDVAVRTLKE
PPVTLVKESLEVDTKQDIISNNSEEHITHNLNDQVDSPSPKEDSHIGKEEDIPDSSKISL
SSKKPVSKKKYSQFEGSFFGSESDEDSVRTSSSQRSHDLKISASIEKERDIKKSSAPLKS
EDLGKSSRSKTEREDKYFSYSKLERDTRYVSSRCRSERERRRSRSRSRSDRGSRASLSYS
RSERSHYYDSDRRYHRSSPYRERTRYSRPYTDNRGRESSDSEDEYKKTYSRRTSSHSSSY
RDLRTSSYSKSDRDCKTETSYLDIERRGKYSSKLERESKRTSENEAIKRCCSPPSDLGFR
WGSSYSKHDYSASRYKSALSKSIPKSDKFKNSFCCTELNEESKQSHSSSLQTPCSKGSEL
RTVSKIPEREKTGSPSASNRLNDSPTFKKLDESPIFKSEFIGRDSHDSIKELDSLSKVKN
DKLKNFCPIELNINGSPGAESDVTTFCTSKTDAVLMTSDDSVTGSEVSPLVKACISSSNG
FQSISRCKEKDLDTCMQHSKSQSPFKETEPLVSPCSDNMSLPVMTTDYSKTEKEPVDMRV
SCCKTKDSDRYCTANESNPSLCYSEAETVEPSVTKISSNSFKNVHLESKTVVCDKRNLTD
QHSKFTCEEYKQSVGSTSSASVNHLDDLYEPIGSSSIGSSLQSLPPGIKVDSLTLLPCGE
NTSPVLDGVLKSKKSTEVLKHTGKEKIVDVGSGFSNSGKAFASWENRHNNGLSGKCLQEA
QEEGNSILPDRRGRPEISLDEGVRGHAHTSDDSEVVLSSCDLNLTVEDDGVTYTLKCDSS
GHAPEIVSTVHEDYSGSSESSSDESDSEDTDSDDSSIPRNRLQSVVVVPKNSTLPMEETS
PCSSRSSQSYKHYSDHWEDERLELRRYSYEEKFENITSKGCPQTEKFFFHKGTEKNPEIS
FIQSSRKQVDNHLPEIAHSQSDGVDSTSHTDMKSDLLGHSNSEEITKAKTSFRQQDELPV
YSDDFEDIPSKSRQQTTFPNRPDSRLGKTELNFSSCDISCMDGLHSSEELRNLGWNFSQQ
EKPTTTYQQPDSSYGVCGAHRYQQSAEQYGGNRNYWQGNGYWDPRSAGRPPGSGVAYDRI
QGQVPDSLTDDREEEENWDQRGESHFLSQSNKFLLSLQKDKGSVQAPEISSNSVRDSLAV
NERKDFSKNLEKSDIKDRGPLKKRRQELESDSESDGELQDRKKVRVDIEQGGAKIESVQK
TGFIKGPMFKGVASSRFLPKGTKTKVNLEEQGRQKVSFSFSLTKKTLQNRFLTALGNEKQ
NDTPNSPALSQGDSTPKIKVDIGDTLATTEESSPPKSRVELGKIHFKKHLLHVTSRPLLA
TTSAVASPSPPPVQLPAVIPESTTIDSPPSSPPPPPPPPQATTPSSPAPITEPVASPHTP
VTVLTTAPLSLPVDVAVRTLKEPPVTLVKESLEVDTKQDIISNNSEEHITHNLNDQVDSP
SPKEDSHIGKEEDIPDSSKISLSSKKPVSKKKYSQFEGSFFGSESDEDSVRTSSSQRSHD
LKISASIEKERDIKKSSAPLKSEDLGKSSRSKTEREDKYFSYSKLERDTRYVSSRCRSER
ERRRSRSRSRSDRGSRASLSYSRSERSHYYDSDRRYHRSSPYRERTRYSRPYTDNRGRES
SDSEDEYKKTYSRRTSSHSSSYRDLRTSSYSKSDRDCKTETSYLDIERRGKYSSKLERES
KRTSENEAIKRCCSPPSDLGFRWGSSYSKHDYSASRYKSALSKSIPKSDKFKNSFCCTEL
NEESKQSHSSSLQTPCSKGSELRTVSKIPEREKTGSPSASNRLNDSPTFKKLDESPIFKS
EFIGRDSHDSIKELDSLSKVKNDKLKNFCPIELNINGSPGAESDVTTFCTSKTDAVLMTS
DDSVTGSEVSPLVKACISSSNGFQSISRCKEKDLDTCMQHSKSQSPFKETEPLVSPCSDN
MSLPVMTTDYSKTEKEPVDMRVSCCKTKDSDRYCTANESNPSLCYSEAETVEPSVTKISS
NSFKNVHLESKTVVCDKRNLTDQHSKFTCEEYKQSVGSTSSASVNHLDDLYEPIGSSSIG
SSLQSLPPGIKVDSLTLLPCGENTSPVLDGVLKSKKSTEVLKHTGKEKIVDVGSGFSNSG
KAFASWENRHNNGLSGKCLQEAQEEGNSILPDRRGRPEISLDEGVRGHAHTSDDSEVVLS
SCDLNLTVEDDGVTYTLKCDSSGHAPEIVSTVHEDYSGSSESSSDESDSEDTDSDDSSIP
RNRLQSVVVVPKNSTLPMEETSPCSSRSSQSYKHYSDHWEDERLELRRYSYEEKFENITS
KGCPQTEKFFFHKGTEKNPEISFIQSSRKQVDNHLPEIAHSQSDGVDSTSHTDMKSDLLG
HSNSEEITKAKTSFRQQDELPVYSDDFEDIPSKSRQQTTFPNRPDSRLGKTELNFSSCDI
SCMDGLHSSEELRNLGWNFSQQEKPTTTYQQPDSSYGVCGAHRYQQSAEQYGGNRNYWQG
NGYWDPRSAGRPPGSGVAYDRIQGQVPDSLTDDREEEENWDQRGESHFLSQSNKFLLSLQ
KDKGSVQAPEISSNSVRDSLAVNERKDFSKNLEKSDIKDRGPLKKRRQELESDSESDGEL
QDRKKVRVDIEQGGTSVPPGSELIGPSCVMDDFRDPQRWKECAKQGKMPCYFDLIEENVY
LTERKKNKSHRDIKRMQCECTPLSKDERAQGEIACGEDCLNRLLMIECSSRCPNGDYCSN
RRFQRKQHADVEVILTEKKGWGLRAAKDLPSNTFVLEYCGEVLDHKEFKARVKEYARNKN
IHYYFMALKNDEIIDATQKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLVPSGSE
LTFDYQFQRYGKEAQKCFCGSANCRGYLGGENRVSIRAAGGKMKKERSRKKDSVDGELEA
LMENGEGLSDKNQVLSLSRLMVRIETLEQKLTCLKLIQNTHSQSCLKSFLERHGLSLLWI
WMAELGDGRESNQKLQEEIIKTLEHLPIPTKNMLEESKVLPIIQRWSQTKTTAPQLSEGD
GYSSENTSRAHTPLNTPDPSTKLSTEADTDTPKKLMFRRLKIISENSMDSAVSDAASELE
GKDGKEDLDQLENVTVEEEEEMQSRQLFPEQLPEFKVESETTVEASKLPTLEPEADAEME
PKESSGTKLEEPIAEETPSQDEEEGVSDVESERSQEQPDKTVDISDLATKLLDSWKDLKE
VYRIPKKSQTEKESTVTERGRDAVGLRDQTAAPKTPNRSRERDLDKQTQSKEKRKRRGSL
SPPSSAYERGTKRSDDRYDTPTSKKKVRIKDRNKLSTEERRKLFEQEVAQREAQKQQQHV
QQQYSPAQSQATIYYQGQTCPSVYGVTSYSQTTPPIVQSYAQPSLQYIQGQQIFTAHPQG
VVVQPTAAVTTIVTPGQPQPLQPPEMVVTNNLLDLPPPSPPKPKTIVLPPNWKTARDPEG
KIYYYHVITRQTQWDPPTWESPGDDASLEHEAEMDLGTPTYDENPMKTSKKPKTAEADTS
SELAKKSKEVFRKEMSQFIVQCLNPYRKPDCKVGRITTTEDFKHLARKLTHGVMNKELKY
CKNPEDLECNENVKHKTKEYIKKYMQKFGAVYKPKEDTELE
NT seq 11466 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagctgccgccacagcagccgcctccgaagatgggggatttctacgaccccgag
cacccgacccccgaagaagaagaaaatgaggcaaagattgaaagtgtgcagaaaacaggt
ttcatcaaaggaccaatgttcaaaggtgttgcttctagtcgatttttgcccaaaggcacc
aagacaaaagttaatttggaggaacaaggacgacagaaggtgtcattcagcttcagcctt
acaaaaaaaactttgcagaataggtttcttaccgcacttggcaatgaaaaacaaaatgat
actccaaactcccctgctttatctcaaggagactcaactcctaaaattaaagtggacatt
ggagataccttagctactacagaagaatcttccccaccaaaatcaagagtggaattgggc
aaaattcattttaaaaaacatctgcttcatgtgacttccaggccactgctggctactacc
tcagcagtagcatctccatctcctcccccagtacagttaccagcagtcataccagaatca
acaactatagactcaccaccttcatctccacctccaccacctccacctccccaagccaca
acaccctcatcaccagcaccaataacagagccagtggcctcaccacacacaccagtaaca
gttctcacgacagcaccactatccttaccagtagatgtagcagttagaactctgaaagaa
ccaccagttacacttgtaaaagagtctttagaagtggatactaagcaggacattatatct
aacaattcagaagaacacataactcacaatctgaatgatcaagtagatagtccttcacca
aaagaagattcccatattgggaaggaagaagatattccagatagttctaagattagtctg
agctctaaaaaaccggtttctaagaagaaatattcacaatttgaaggctcattttttggc
tcagaatctgatgaagattctgtaaggacttcctccagtcaaagatcacatgatttaaaa
atttcagcaagcattgaaaaggaaagagatattaaaaagagctcagcgcctttaaaaagt
gaagatttaggaaaatcttcaaggtctaaaacagaaagagaagataaatattttagctac
tcaaaacttgaaagagatactcggtatgtatcttcccgatgtagatcagaaagagagcga
aggcggagcagatctcgttccagatctgacagggggtctagagctagcctatcctattcc
cggtcagaacgatctcattattatgactctgatcgacgctaccataggagttccccttat
cgagagaggacacgctattctcggccatatacagataacaggggacgagagagttccgac
tctgaagatgaatataagaagacatactcaaggcgcacctcgtctcattcctcctcttac
agagacctgagaacatcatcctattctaaatctgatcgggactgcaaaactgagacctct
tacttagacatagagagaagaggaaagtattcttccaaactagagagagaatccaaaagg
acttcagaaaatgaagcaataaaaagatgttgttctcctcctagtgatctgggattccga
tgggggtcctcatattctaagcacgattatagtgcttcccgctacaaatctgccctttca
aagtccatacccaagtctgacaaatttaaaaattctttctgttgtacagaattaaatgag
gaaagcaaacagtctcattcttctagtttacagactccttgttcaaaaggtagtgagtta
agaactgttagtaaaattcctgaaagagaaaagactgggtctccatctgcatcaaatcgg
ttaaatgattcacctacttttaaaaagctagatgaatcacctatttttaagtcagaattt
ataggacgtgatagccatgatagtattaaagaattggactctttatctaaagtgaagaat
gataaattaaaaaacttttgtcccattgaattaaatataaacggatctcctggggcagaa
tctgatgtgacaacattttgcacttctaaaactgatgctgttttgatgacatctgatgat
agtgtgactggatcagaggtatctcctttggtcaaagcatgcatatcttcatcaaatgga
tttcagagtattagtaggtgcaaggaaaaagacttggacacttgcatgcagcatagtaag
tcacaaagtccatttaaagaaacagaacctttggtgtcaccatgcagtgataatatgtct
ttgccagttatgactacagattattctaaaacagaaaaagagccagttgatatgagagtt
tcttgctgtaaaaccaaagattcagatagatattgtactgcaaatgagagtaacccttct
ttgtgttattctgaagctgaaactgttgagccttcagttacgaagatttcttcaaatagc
tttaagaatgtacatttggaatcaaaaacagttgtatgtgataagagaaatctgacagat
cagcactcaaaatttacatgtgaagagtataaacagagtgttggtagcactagttcagct
tctgttaatcatttggatgatttatatgaacctattgggagttcaagtattggttcatct
cttcagagtcttccaccaggaataaaagtggacagtttgactctcttgccatgtggtgag
aacacatctccagttctggatggagtgctgaagagtaaaaagagcacagaggttttaaag
catacagggaaagaaaaaatagtagacgtaggtagtggcttttctaattcaggaaaggca
tttgcctcttgggaaaacaggcataataatgggctatctgggaaatgtttgcaagaggct
caagaagaagggaattccatattgcctgatagaagaggaagaccagagatctctttagat
gaaggagtaagggggcatgcacatacatctgatgactcagaagttgtactttcttcttgt
gatttgaatttaactgtggaagatgatggtgtaacttacaccttaaaatgtgatagtagt
ggtcatgcccctgaaattgtgtctactgtccatgaagattattctggttcctctgaaagt
tcaagtgatgaaagtgattcagaagatacagattctgatgacagcagtattccaagaaac
cgtctccaatctgttgtggttgtgccaaagaattctactttgcctatggaagaaacaagt
ccatgttcttcccggagcagtcaaagttataagcattattccgaccactgggaagatgag
agattagagttaaggaggtattcatatgaggaaaaatttgagaatataacaagtaaaggc
tgtcctcaaactgaaaagttcttttttcataaaggtacagagaagaatccagaaatttct
tttatacaatccagcagaaaacaagtagataaccacctgcctgaaattgcccattctcag
agtgatggtgttgatagtacaagtcatacagatatgaaatctgaccttctgggtcactca
aattcagaagaaataacaaaagccaaaacatcctttaggcaacaagatgagctaccagtt
tattctgatgattttgaagatatcccaagtaaatctcggcaacagaccactttccctaac
aggccagatagtagacttggaaaaacagagttgaatttttcttcttgtgatatctcatgc
atggatggcttgcactcatcagaagagctcagaaacctagggtggaacttctctcaacaa
gaaaagcctactaccacatatcagcaacctgacagcagttatggagtctgtggtgcacac
aggtatcagcaaagtgcagaacaatatggtgggaaccgtaattactggcaaggcaatggc
tactgggatccaagatcagcaggtagacctcctggatctggggtcgcttatgaccgaatt
caagggcaggttccagattccttaacagatgatcgtgaagaggaagagaattgggatcaa
cggggtgaatctcactttttaagccagtctaataaatttcttctgtcccttcagaaggac
aaggggtcggtgcaagcacctgaaataagcagcaattccgttagggactctttagctgta
aatgaaagaaaagacttttcaaaaaacctagaaaaaagtgatattaaagatcgagggcct
cttaaaaaaaggaggcaggaattggaaagtgattctgaaagtgatggtgagcttcaggat
agaaagaaagttagagtggatatagaacagggaggggcaaagattgaaagtgtgcagaaa
acaggtttcatcaaaggaccaatgttcaaaggtgttgcttctagtcgatttttgcccaaa
ggcaccaagacaaaagttaatttggaggaacaaggacgacagaaggtgtcattcagcttc
agccttacaaaaaaaactttgcagaataggtttcttaccgcacttggcaatgaaaaacaa
aatgatactccaaactcccctgctttatctcaaggagactcaactcctaaaattaaagtg
gacattggagataccttagctactacagaagaatcttccccaccaaaatcaagagtggaa
ttgggcaaaattcattttaaaaaacatctgcttcatgtgacttccaggccactgctggct
actacctcagcagtagcatctccatctcctcccccagtacagttaccagcagtcatacca
gaatcaacaactatagactcaccaccttcatctccacctccaccacctccacctccccaa
gccacaacaccctcatcaccagcaccaataacagagccagtggcctcaccacacacacca
gtaacagttctcacgacagcaccactatccttaccagtagatgtagcagttagaactctg
aaagaaccaccagttacacttgtaaaagagtctttagaagtggatactaagcaggacatt
atatctaacaattcagaagaacacataactcacaatctgaatgatcaagtagatagtcct
tcaccaaaagaagattcccatattgggaaggaagaagatattccagatagttctaagatt
agtctgagctctaaaaaaccggtttctaagaagaaatattcacaatttgaaggctcattt
tttggctcagaatctgatgaagattctgtaaggacttcctccagtcaaagatcacatgat
ttaaaaatttcagcaagcattgaaaaggaaagagatattaaaaagagctcagcgccttta
aaaagtgaagatttaggaaaatcttcaaggtctaaaacagaaagagaagataaatatttt
agctactcaaaacttgaaagagatactcggtatgtatcttcccgatgtagatcagaaaga
gagcgaaggcggagcagatctcgttccagatctgacagggggtctagagctagcctatcc
tattcccggtcagaacgatctcattattatgactctgatcgacgctaccataggagttcc
ccttatcgagagaggacacgctattctcggccatatacagataacaggggacgagagagt
tccgactctgaagatgaatataagaagacatactcaaggcgcacctcgtctcattcctcc
tcttacagagacctgagaacatcatcctattctaaatctgatcgggactgcaaaactgag
acctcttacttagacatagagagaagaggaaagtattcttccaaactagagagagaatcc
aaaaggacttcagaaaatgaagcaataaaaagatgttgttctcctcctagtgatctggga
ttccgatgggggtcctcatattctaagcacgattatagtgcttcccgctacaaatctgcc
ctttcaaagtccatacccaagtctgacaaatttaaaaattctttctgttgtacagaatta
aatgaggaaagcaaacagtctcattcttctagtttacagactccttgttcaaaaggtagt
gagttaagaactgttagtaaaattcctgaaagagaaaagactgggtctccatctgcatca
aatcggttaaatgattcacctacttttaaaaagctagatgaatcacctatttttaagtca
gaatttataggacgtgatagccatgatagtattaaagaattggactctttatctaaagtg
aagaatgataaattaaaaaacttttgtcccattgaattaaatataaacggatctcctggg
gcagaatctgatgtgacaacattttgcacttctaaaactgatgctgttttgatgacatct
gatgatagtgtgactggatcagaggtatctcctttggtcaaagcatgcatatcttcatca
aatggatttcagagtattagtaggtgcaaggaaaaagacttggacacttgcatgcagcat
agtaagtcacaaagtccatttaaagaaacagaacctttggtgtcaccatgcagtgataat
atgtctttgccagttatgactacagattattctaaaacagaaaaagagccagttgatatg
agagtttcttgctgtaaaaccaaagattcagatagatattgtactgcaaatgagagtaac
ccttctttgtgttattctgaagctgaaactgttgagccttcagttacgaagatttcttca
aatagctttaagaatgtacatttggaatcaaaaacagttgtatgtgataagagaaatctg
acagatcagcactcaaaatttacatgtgaagagtataaacagagtgttggtagcactagt
tcagcttctgttaatcatttggatgatttatatgaacctattgggagttcaagtattggt
tcatctcttcagagtcttccaccaggaataaaagtggacagtttgactctcttgccatgt
ggtgagaacacatctccagttctggatggagtgctgaagagtaaaaagagcacagaggtt
ttaaagcatacagggaaagaaaaaatagtagacgtaggtagtggcttttctaattcagga
aaggcatttgcctcttgggaaaacaggcataataatgggctatctgggaaatgtttgcaa
gaggctcaagaagaagggaattccatattgcctgatagaagaggaagaccagagatctct
ttagatgaaggagtaagggggcatgcacatacatctgatgactcagaagttgtactttct
tcttgtgatttgaatttaactgtggaagatgatggtgtaacttacaccttaaaatgtgat
agtagtggtcatgcccctgaaattgtgtctactgtccatgaagattattctggttcctct
gaaagttcaagtgatgaaagtgattcagaagatacagattctgatgacagcagtattcca
agaaaccgtctccaatctgttgtggttgtgccaaagaattctactttgcctatggaagaa
acaagtccatgttcttcccggagcagtcaaagttataagcattattccgaccactgggaa
gatgagagattagagttaaggaggtattcatatgaggaaaaatttgagaatataacaagt
aaaggctgtcctcaaactgaaaagttcttttttcataaaggtacagagaagaatccagaa
atttcttttatacaatccagcagaaaacaagtagataaccacctgcctgaaattgcccat
tctcagagtgatggtgttgatagtacaagtcatacagatatgaaatctgaccttctgggt
cactcaaattcagaagaaataacaaaagccaaaacatcctttaggcaacaagatgagcta
ccagtttattctgatgattttgaagatatcccaagtaaatctcggcaacagaccactttc
cctaacaggccagatagtagacttggaaaaacagagttgaatttttcttcttgtgatatc
tcatgcatggatggcttgcactcatcagaagagctcagaaacctagggtggaacttctct
caacaagaaaagcctactaccacatatcagcaacctgacagcagttatggagtctgtggt
gcacacaggtatcagcaaagtgcagaacaatatggtgggaaccgtaattactggcaaggc
aatggctactgggatccaagatcagcaggtagacctcctggatctggggtcgcttatgac
cgaattcaagggcaggttccagattccttaacagatgatcgtgaagaggaagagaattgg
gatcaacggggtgaatctcactttttaagccagtctaataaatttcttctgtcccttcag
aaggacaaggggtcggtgcaagcacctgaaataagcagcaattccgttagggactcttta
gctgtaaatgaaagaaaagacttttcaaaaaacctagaaaaaagtgatattaaagatcga
gggcctcttaaaaaaaggaggcaggaattggaaagtgattctgaaagtgatggtgagctt
caggatagaaagaaagttagagtggatatagaacagggagggacctcagtgcccccaggt
tcagagctgattgggccttcctgtgtcatggatgacttcagagacccacagcgatggaag
gaatgtgccaagcaggggaagatgccttgttactttgatcttattgaagaaaatgtttat
ttaacagaaagaaagaagaataaatcccaccgggacattaagcgaatgcaatgtgagtgt
acacctctttccaaagatgaaagagctcaaggtgaaatagcatgtggggaagattgtctt
aatcgtctcctcatgattgaatgttcttctcggtgtccgaatggggattactgttccaat
agacggtttcagagaaaacagcatgcagatgtggaagtcattcttacagaaaagaaaggt
tggggcttaagagcggccaaagatcttccttcgaacacctttgtcctggaatattgtgga
gaggtacttgatcataaagaatttaaagctcgggtgaaggaatatgcacgaaacaaaaac
atccattactatttcatggccctgaagaacgatgagataatagatgccactcagaaagga
aactgctctcgtttcatgaatcacagctgtgaaccaaactgtgaaacccaaaaatggact
gtgaatggacagctgagagttggtttttttaccaccaaactggttccttcaggctcagag
ttaacatttgactatcagtttcaaagatatggaaaagaagctcaaaaatgtttctgcggg
tctgctaattgccgaggttacctgggaggagaaaacagagtcagtatcagagctgctgga
gggaaaatgaaaaaggaacgctctcgtaagaaggattcagtagatggagagctagaagca
ctgatggaaaatggtgaaggtctttctgataaaaaccaggtgctcagtttatcccggtta
atggttcgaattgaaactttggagcagaaacttacctgtctcaagcttattcagaataca
cactcacaatcctgcctgaagtcctttctggaacgacatgggctgtctttgttatggatc
tggatggcagagcttggtgatggccgggaaagtaaccagaagcttcaggaagagatcata
aagaccttggagcacttacccattcctactaaaaatatgttggaggaaagcaaagtactt
ccaattattcagcgttggtctcagaccaagactactgctccccaattgagtgaaggagat
gggtattccagtgaaaatacatctcgtgcacacacccccctcaatacacctgatccttct
accaagctgagcacagaagctgacacagacactcccaagaagctcatgtttcgcagactt
aaaattataagtgaaaatagcatggatagtgcagtctctgatgcagccagtgagctggaa
ggcaaggatggcaaagaggaccttgatcagttagaaaatgtcactgtagaggaagaggaa
gagatgcagtcacgacagctattccctgaacagctgcctgaattcaaagttgagagtgaa
accactgtggaggccagtaaacttcccacattggaaccagaagctgacgctgagatggag
cccaaagagagcagtggcaccaagttggaagaacccattgctgaggaaacaccatcccag
gatgaagaggagggcgtgtctgatgtggagagtgagaggagccaagaacagccagataaa
acagtggatataagtgatttggccaccaagctactggacagttggaaagacttaaaggag
gtgtatcgaattccaaagaaaagtcaaactgaaaaggagagcacagtaactgagcgagga
agagatgctgttggactcagagatcaaacagctgccccaaagactcctaacaggtcaaga
gagagagatctagataagcagactcagagtaaagagaaaaggaaacgaaggggctccctc
tcaccaccttcttctgcctatgagcggggaacaaaaaggtcagatgacaggtatgacaca
ccaacttctaaaaagaaggtacgaattaaagaccgcaataaactctctacagaggaacgc
cgaaagttgtttgagcaagaagtggctcagcgggaggctcagaaacagcagcagcatgta
cagcagcagtactctcctgcacaatctcaagcaaccatatattatcaaggacagacatgt
ccaagtgtttatggtgtgacatcttattcacagacaactccaccaattgtacagagttat
gcccagccaagtcttcagtatatccagggacagcaaattttcacagctcacccacaagga
gtggtggtacagccaactgcagccgtaactacaattgttactccagggcagccacaacct
ttacagccacctgaaatggttgtgacaaataatctactggacctgccacccccatctcct
cccaaaccaaaaaccattgtcttacctcccaactggaagacagcccgagatccagaaggg
aagatttattactaccatgtgatcacaaggcagactcagtgggatccgcctacttgggaa
agcccaggagatgatgccagccttgagcatgaagctgagatggacctgggaaccccaaca
tatgatgaaaaccccatgaagacatcaaaaaagcccaagacagcagaagcagacacttcc
agtgagctggctaagaaaagcaaagaagtgttcagaaaagagatgtctcagttcatcgtc
cagtgcctgaacccttaccggaaacctgactgcaaagtaggcagaatcaccacaactgag
gatttcaaacacttagctcgaaagctgactcatggtgttatgaacaaggagctgaagtac
tgtaagaaccctgaggacctggagtgcaatgagaatgtgaaacacaaaaccaaggagtat
ataaagaagtacatgcagaagtttggggctgtttacaaacccaaagaggacacggagtta
gagtga

DBGET integrated database retrieval system