KEGG   Halorhodospira halophila: Hhal_0159
Entry
Hhal_0159         CDS       T00462                                 

Definition
(GenBank) protein of unknown function DUF796
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
hha  Halorhodospira halophila
Pathway
hha03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:hha00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Hhal_0159
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hha02044]
    Hhal_0159
Secretion system [BR:hha02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Hhal_0159
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: ABM60953
UniProt: A1WTE1
LinkDB
Position
complement(185637..186122)
AA seq 161 aa
MAIPAYMWLKDDQGNEIEGSVTITDREGSIEVLGFEHELRIPTDSDTGALTGTRKHEPFV
FTKAFDSASPYLYKACSKGQTLEELVLSWYQIDESGNEQEYFRHTLNDVKITSVRPVMHN
VKEADKERFPHMEQVAIRYGRITWAYVDGNIEFSDSWTEGR
NT seq 486 nt   +upstreamnt  +downstreamnt
atggcgattcctgcctacatgtggctcaaggacgatcagggcaacgagatcgaggggtcg
gtgaccatcaccgaccgcgagggcagcatcgaggtgctcggcttcgagcacgagctacgc
atccccacggacagcgacaccggtgccctgaccggtacgcgcaagcacgaaccgttcgtc
ttcaccaaggccttcgattcggcctcaccctacctctacaaggcgtgcagcaaggggcag
acgctcgaggagctggtgctgagctggtaccagatcgacgagtcgggcaacgagcaggag
tactttcggcacaccctcaacgacgtgaagatcacctcggtgcgcccggtgatgcacaac
gtcaaggaggccgataaggagcgcttcccgcacatggagcaggtggccatccgctatggc
cggatcacttgggcttacgtggacgggaacatcgagttctccgactcctggaccgagggc
cggtga

DBGET integrated database retrieval system