KEGG   Haloarcula hispanica N601: HISP_14475Help
Entry
HISP_14475        CDS       T02949                                 

Definition
(GenBank) cystathionine beta-lyase
  KO
K01758  cystathionine gamma-lyase [EC:4.4.1.1]
Organism
hhn  Haloarcula hispanica N601
Pathway
hhn00260  Glycine, serine and threonine metabolism
hhn00270  Cysteine and methionine metabolism
hhn00450  Selenocompound metabolism
hhn01100  Metabolic pathways
hhn01130  Biosynthesis of antibiotics
hhn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hhn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HISP_14475
   00270 Cysteine and methionine metabolism
    HISP_14475
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    HISP_14475
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hhn04147]
    HISP_14475
Enzymes [BR:hhn01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.1  cystathionine gamma-lyase
     HISP_14475
Exosome [BR:hhn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HISP_14475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP DegT_DnrJ_EryC1 Aminotran_1_2 Aminotran_5 Beta_elim_lyase Met_gamma_lyase
Motif
Other DBs
NCBI-ProteinID: AHB67150
UniProt: V5TRB5
LinkDB All DBs
Position
1:2749386..2750621
Genome map
AA seq 411 aa AA seqDB search
MIAKVLAPASRRKRMTRRPHLDTIAVDTETASAAGDVTLPIHLSSTYELAGLDTDLSLED
VDPGEGEFLYSRLSNPTRHGLEQELAALEDGERAYAFSSGTAAVATAVLSLVEPGDHVVA
FDDLYAGTRRMFETLFRDQLGVDVEFVDATDADAVAAAMTPATELVWVETPTNPLIKLCD
IDAIAAVAADYDATLGVDNTFASPYFQQPLSLGADLVVHSTTKYLNGHSDAVGGALITND
PEVAERVEFRQQIALGNMLAPFDSYLISRGIKTLGVRMTRHENNAMALAQYLDDHERVET
VHYPGLESHPQHDLAREQMQGFGGVLSFELAGDMADAKRFLEALETVTLAVSLGGVESLA
ELPAAMTHEPLSPAARDELGISDTLIRLSVGIEAVEDLRADLERGFAAIES
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgattgcaaaggtattagcgccagccagcagacggaagcgtatgactcggcgtccacac
ctcgacacgattgcagtcgataccgagacggcgtcagcagcaggggatgtcacgctcccg
atacacctctcgtcgacctacgaactagccgggctcgacacggacctctctctggaggac
gtcgaccccggtgaaggcgagttcctctactcgcggctgtcgaacccgacacgacacggc
ctcgaacaggagttagccgcgctagaggacggagagcgagcctatgccttcagttcgggg
acagcggccgttgcaacagcggtgctctcactggtcgaaccgggcgaccacgtcgttgcg
ttcgacgacctgtacgcgggcacgcgacggatgttcgaaacgctgttccgggaccagctt
ggcgtcgacgtggagttcgtcgacgcaactgacgccgacgctgtcgcggccgcgatgacg
ccggcaacggagttagtctgggtcgagaccccgacaaatccactgataaaactctgtgac
atcgacgcgattgcggccgtcgccgccgactacgacgcgacgctcggggtcgacaacacc
ttcgcgagtccgtacttccagcagccgctgtccctcggcgcggacctcgtggtccacagc
acgacgaagtacctcaacggccacagcgatgccgtcggcggcgcactgattactaacgac
cccgaggtggccgagcgggtggagttccgccagcagatcgcgctcgggaacatgctcgcc
ccgttcgacagctatctcatctcgcggggcatcaagacgctgggtgtccggatgactcgc
cacgagaacaacgctatggccctcgcgcagtacctcgacgaccacgagcgcgtcgaaacg
gtccactacccagggttagagagtcacccacagcacgacctggctcgcgagcagatgcag
ggctttggcggcgtgctctcgttcgaactggccggagacatggccgacgccaagcgcttc
ctcgaagcgttagagacggtgacgctggcagtcagcctcggcggcgtcgagagcctggcg
gagctcccggcggcgatgacacacgaacccctctcaccggctgcgcgggacgaactcggc
atctctgacacgcttatccgcctttcggtgggtatcgaagccgtcgaggacctccgggcc
gacctggagcgcggtttcgcggcgattgagtcctga

DBGET integrated database retrieval system