Haemophilus haemolyticus: NCTC10839_01834 Help Entry NCTC10839_01834   CDS       T06216                                  Symbol acpP Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism hhz  Haemophilus haemolyticus Pathway hhz01100   Metabolic pathways hhz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hhz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NCTC10839_01834 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NCTC10839_01834 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF1896 Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  SQH97896 UniProt:  A0A0M3G3F9 LinkDB All DBs Position 1:complement(1888523..1888753) Genome browser AA seq 76 aa AA seqDB search MSIEERVKKIIVEQLGVKEEDVKSEASFVEDLGADSLDTVELVMALEEEFDIEIPDEEAE KITTVQSAIDYVQNNQ NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgagtattgaagaacgcgtgaaaaaaatcatcgttgaacaattaggtgttaaagaagaa gatgttaaatctgaagcttctttcgttgaagatttaggtgcggactctttagacacagtt gaattagtaatggctttagaagaagaattcgatatcgaaattccagatgaagaagctgaa aaaatcacaactgttcaatctgcgattgactacgtgcaaaacaatcaataa

DBGET integrated database retrieval system