KEGG   Haemophilus influenzae 86-028NP (nontypeable): NTHI0321
Entry
NTHI0321          CDS       T00248                                 

Gene name
arcB
Definition
(GenBank) aerobic respiration control sensor protein ArcB
  KO
K07648  two-component system, OmpR family, aerobic respiration control sensor histidine kinase ArcB [EC:2.7.13.3]
Organism
hit  Haemophilus influenzae 86-028NP (nontypeable)
Pathway
hit02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hit00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NTHI0321 (arcB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hit01001]
    NTHI0321 (arcB)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:hit02022]
    NTHI0321 (arcB)
Enzymes [BR:hit01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     NTHI0321 (arcB)
Protein kinases [BR:hit01001]
 Histidine kinases
  OmpR family
   NTHI0321 (arcB)
Two-component system [BR:hit02022]
 OmpR family
  ArcB-ArcA (anoxic redox control)
   NTHI0321 (arcB)
SSDB
Motif
Pfam: HKR_ArcB_TM HATPase_c Response_reg HisKA Hpt HATPase_c_3 HATPase_c_5 COG5 DUF3810
Other DBs
NCBI-ProteinID: AAX87279
UniProt: Q4QNW8
LinkDB
Position
complement(303030..304871)
AA seq 613 aa
MHRFFYNDNNVLGDLMKNFKYFAQSYVDWVIRLGRLRFSLLGVMILAVLALCTQILFSLF
IVHQISWVDIFRSVTFGLLTAPFVIYFFTLLVEKLEHSRLDLSSSVNRLENEVAERIAAQ
KKLSQALEKLEKNSRDKSTLLATISHEFRTPLNGIVGLSQILLDDELDDLQRNYLKTINI
SAVSLGYIFSDIIDLEKIDASRIELNRQPTDFPALLNDIYNFASFLAKEKNLIFSLELEP
NLPNWLNLDRVRLSQILWNLISNAVKFTDQGNIILKIMRNQDCYHFIVKDTGMGISPEEQ
KHIFEMYYQVKESRQQSAGSGIGLAISKNLAQLMEGDLTVESERGKGATFHLTLHAQEIS
EKESVKKNIPSLNILLVEDVDLNIMVAKTILEKLGHHVDVATNGKQAITLFEKNVYDILL
LDIKLPDMSGFEIAQYLRENYENGIYDFLPPMIAFTANVMQSEQEYLEMGMDGVLRKPIS
IKDLHHCLQQFFADESESIIEMNDDNELSEQFDLALIETLGKKQILENLSLFKQTMPNYL
AQLSKDNMKETEDTAHKIKGAAASVGLNHLRQLADTLESAAKNSDVFNCGELIDEIGNLW
LEDVEDLLKFCKF
NT seq 1842 nt   +upstreamnt  +downstreamnt
atgcacaggtttttttataacgataataatgttttaggagatttgatgaaaaatttcaaa
tattttgctcagagttatgtggattgggttattcgtcttgggcgtcttcgtttttctctt
ttaggcgtgatgattctcgcggttttagccctttgtactcagattttatttagtctattt
attgttcatcagatatcttgggtagatatttttcgttctgtaacttttggcttactcact
gcgccttttgttatttattttttcactttattagtagaaaaacttgaacattctcgtctt
gatctttctagctcggttaatcgattggaaaatgaggtcgccgagcgaattgctgctcag
aaaaaattatcccaagcattggaaaagttagaaaaaaatagccgtgataaaagtacctta
cttgccacaataagccatgaatttcgcacgccattgaatgggattgtcgggcttagtcaa
attttacttgatgatgaattggatgatctccagcgtaattatttaaaaactatcaacata
agtgcggtcagtttaggctatatttttagcgatattattgatttggaaaaaattgatgcc
agccgaattgaattaaatcgccagccaacagatttccccgccttattaaacgatatttat
aattttgctagtttcctcgccaaagaaaaaaatcttattttttctttagagcttgaacct
aatttgcctaattggttgaatcttgatcgtgttcgcttgagccaaattttgtggaactta
attagtaatgcggtgaagtttacggatcagggaaatattattcttaaaattatgagaaat
caggattgttaccattttattgtgaaagatacaggaatggggatttcacctgaagaacaa
aaacatatttttgaaatgtattatcaagtgaaagaaagccgtcagcaaagtgcgggtagc
ggtattgggttggctatttctaaaaatctcgctcagttaatggaaggggatttaacagtt
gaaagtgagcgaggaaaaggcgcgactttccatcttactctccacgctcaggaaatttct
gaaaaagaatctgttaagaaaaatataccatccttgaatattcttttagtggaagatgtt
gatctcaatattatggttgcaaaaactattttagaaaaacttgggcatcatgttgatgtt
gcgacaaatggcaagcaggcgattactttatttgagaaaaatgtttacgacattctattg
ctcgatattaaattaccagatatgagtggttttgaaattgcccaatatttgcgagagaac
tatgaaaacggtatttatgattttttaccgccaatgattgcttttaccgcgaatgttatg
caaagcgagcaagaatatttagaaatgggcatggatggcgtattacgtaaacccatttca
attaaggatttacaccattgtctacagcaattttttgcagatgaaagcgaatctattata
gaaatgaatgatgataatgagctttcagaacagtttgatttagcgctgatagaaacactt
ggaaaaaaacaaattttagaaaatttatctttattcaaacaaactatgccaaattatctg
gctcaattatcaaaagataatatgaaagaaacagaagataccgcccataaaattaaaggc
gcagcggcatcggtagggttaaatcatttacgtcaattagcggatactttagaaagtgcg
gctaaaaattctgatgtttttaattgtggagaattgattgatgaaattggaaatctttgg
ttagaagatgtggaggatttgcttaaattttgtaaattttaa

DBGET integrated database retrieval system